Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7QO47I)

• DOT Name: Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L)
• Gene Name: RABGAP1L
• Related Disease:
  Benign prostatic hyperplasia
  Esophageal squamous cell carcinoma
  High blood pressure
  Klinefelter syndrome
  Major depressive disorder
  Melanoma
  Migraine disorder
  Mood disorder
  Prostate cancer
  Prostate carcinoma
  Systemic lupus erythematosus
• UniProt ID: RBG10_HUMAN
• Sequence:
  MIENSSWSMTFEERENRRLQEASMRLEQENDDLAHELVTSKIALRNDLDQAEDKADVLNK
  ELLLTKQRLVETEEEKRKQEEETAQLKEVFRKQLEKAEYEIKKTTAIIAEYKQICSQLST
  RLEKQQAASKEELEVVKGKMMACKHCSDIFSKEGALKLAATGREDQGIETDDEKDSLKKQ
  LREMELELAQTKLQLVEAKCKIQELEHQRGALMNEIQAAKNSWFSKTLNSIKTATGTQPL
  QPAPVTQPPKEST

Molecular Interaction Atlas (MIA) of This DOT

11 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Benign prostatic hyperplasia	DISI3CW2	Strong	Altered Expression	[1]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[2]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[3]
Klinefelter syndrome	DISOUI7W	Strong	Genetic Variation	[4]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[5]
Melanoma	DIS1RRCY	Strong	Biomarker	[2]
Migraine disorder	DISFCQTG	Strong	Genetic Variation	[6]
Mood disorder	DISLVMWO	Strong	Genetic Variation	[5]
Prostate cancer	DISF190Y	Strong	Altered Expression	[1]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[1]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[7]

27 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[8]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[9]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[10]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[11]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[12]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[13]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[14]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[15]
Quercetin	DM3NC4M	Approved	Quercetin affects the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[17]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[18]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[19]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[20]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[21]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[22]
Marinol	DM70IK5	Approved	Marinol increases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[23]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[24]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[25]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[27]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[25]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[28]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[25]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[29]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[30]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[31]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[8]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[32]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[17]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[16]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[26]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Rab GTPase-activating protein 1-like, isoform 10 (RABGAP1L).	[26]

References

• [1] Tissue ACE phenotyping in prostate cancer.Oncotarget. 2019 Oct 29;10(59):6349-6361. doi: 10.18632/oncotarget.27276. eCollection 2019 Oct 29.
• [2] Transcriptional gene expression profile of human esophageal squamous cell carcinoma.Genomics. 2003 May;81(5):481-8. doi: 10.1016/s0888-7543(03)00023-5.
• [3] Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.Am J Hypertens. 2010 Jan;23(1):70-7. doi: 10.1038/ajh.2009.190. Epub 2009 Oct 22.
• [4] RABGAP1L gene rearrangement resulting from a der(Y)t(Y;1)(q12;q25) in acute myeloid leukemia arising in a child with Klinefelter syndrome.Virchows Arch. 2009 Mar;454(3):311-6. doi: 10.1007/s00428-009-0732-z. Epub 2009 Jan 28.
• [5] Meta-analysis of genome-wide association studies for neuroticism in 449,484 individuals identifies novel genetic loci and pathways.Nat Genet. 2018 Jul;50(7):920-927. doi: 10.1038/s41588-018-0151-7. Epub 2018 Jun 25.
• [6] Genome-wide meta-analysis identifies new susceptibility loci for migraine.Nat Genet. 2013 Aug;45(8):912-917. doi: 10.1038/ng.2676. Epub 2013 Jun 23.
• [7] Deletion variants of RABGAP1L, 10q21.3, and C4 are associated with the risk of systemic lupus erythematosus in Korean women.Arthritis Rheum. 2013 Apr;65(4):1055-63. doi: 10.1002/art.37854.
• [8] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [9] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [10] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [11] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [12] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [13] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [14] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [15] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [16] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [17] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [18] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [19] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [20] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [21] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [22] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [23] Delta9-tetrahydrocannabinol inhibits cytotrophoblast cell proliferation and modulates gene transcription. Mol Hum Reprod. 2006 May;12(5):321-33. doi: 10.1093/molehr/gal036. Epub 2006 Apr 5.
• [24] Zoledronate dysregulates fatty acid metabolism in renal tubular epithelial cells to induce nephrotoxicity. Arch Toxicol. 2018 Jan;92(1):469-485.
• [25] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [26] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [27] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [28] A novel long noncoding RNA AK001796 acts as an oncogene and is involved in cell growth inhibition by resveratrol in lung cancer. Toxicol Appl Pharmacol. 2015 Jun 1;285(2):79-88.
• [29] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [30] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [31] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [32] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.