Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8CM9CX)

• DOT Name: Myelin proteolipid protein (PLP1)
• Synonyms: PLP; Lipophilin
• Gene Name: PLP1
• Related Disease:
  Amyotrophic lateral sclerosis
  Hereditary spastic paraplegia 2
  Leishmaniasis
  Malaria
  Nervous system inflammation
  Pelizeaus-Merzbacher spectrum disorder
  Primary progressive multiple sclerosis
  Advanced cancer
  Alzheimer disease
  Astrocytoma
  Autism
  Autoimmune disease
  Cerebral palsy
  Chronic renal failure
  Colitis
  Dementia
  Demyelinating polyneuropathy
  Dystonia
  End-stage renal disease
  Epilepsy
  Glioma
  Hereditary spastic paraplegia
  Hypomyelinating leukodystrophy 2
  Hypophosphatasia
  Leiomyoma
  Major depressive disorder
  MASA syndrome
  Mitochondrial disease
  Neuralgia
  Paraplegia
  Pathologic nystagmus
  Peripheral neuropathy
  Pyropoikilocytosis, hereditary
  Relapsing-remitting multiple sclerosis
  Tauopathy
  Uterine fibroids
  Intellectual disability
  Null syndrome
  Pelizaeus-Merzbacher disease in female carriers
  Pelizaeus-Merzbacher disease, classic form
  Pelizaeus-Merzbacher disease, connatal form
  Pelizaeus-Merzbacher disease, transitional form
  Leukodystrophy
  Lysosomal storage disease
  Matthew-Wood syndrome
  Melanoma
  Neoplasm
  Nervous system disease
  Toxoplasmosis
• UniProt ID: MYPR_HUMAN
• PDB ID: 2XPG
• Pfam ID: PF01275
• Sequence:
  MGLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEY
  LINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGG
  QKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNT
  WTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLF
  IAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF
• Function: This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin.

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Amyotrophic lateral sclerosis	DISF7HVM	Definitive	Biomarker	[1]
Hereditary spastic paraplegia 2	DIS0TD1L	Definitive	X-linked	[2]
Leishmaniasis	DISABTW7	Definitive	Biomarker	[3]
Malaria	DISQ9Y50	Definitive	Biomarker	[3]
Nervous system inflammation	DISB3X5A	Definitive	Biomarker	[4]
Pelizeaus-Merzbacher spectrum disorder	DIS1ODJO	Definitive	X-linked	[5]
Primary progressive multiple sclerosis	DISSHDA5	Definitive	Genetic Variation	[6]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[7]
Alzheimer disease	DISF8S70	Strong	Biomarker	[8]
Astrocytoma	DISL3V18	Strong	Altered Expression	[9]
Autism	DISV4V1Z	Strong	Biomarker	[10]
Autoimmune disease	DISORMTM	Strong	Genetic Variation	[11]
Cerebral palsy	DIS82ODL	Strong	Genetic Variation	[12]
Chronic renal failure	DISGG7K6	Strong	Genetic Variation	[13]
Colitis	DISAF7DD	Strong	Biomarker	[14]
Dementia	DISXL1WY	Strong	Genetic Variation	[15]
Demyelinating polyneuropathy	DIS7IO4W	Strong	Genetic Variation	[16]
Dystonia	DISJLFGW	Strong	Biomarker	[17]
End-stage renal disease	DISXA7GG	Strong	Genetic Variation	[13]
Epilepsy	DISBB28L	Strong	Genetic Variation	[18]
Glioma	DIS5RPEH	Strong	Biomarker	[19]
Hereditary spastic paraplegia	DISGZQV1	Strong	Genetic Variation	[20]
Hypomyelinating leukodystrophy 2	DISINIV9	Strong	Genetic Variation	[21]
Hypophosphatasia	DISCQ0O2	Strong	Altered Expression	[22]
Leiomyoma	DISLDDFN	Strong	Altered Expression	[23]
Major depressive disorder	DIS4CL3X	Strong	Altered Expression	[24]
MASA syndrome	DISEFI9B	Strong	Biomarker	[25]
Mitochondrial disease	DISKAHA3	Strong	Genetic Variation	[26]
Neuralgia	DISWO58J	Strong	Biomarker	[27]
Paraplegia	DISSKWBI	Strong	Genetic Variation	[28]
Pathologic nystagmus	DIS1QSPO	Strong	Genetic Variation	[29]
Peripheral neuropathy	DIS7KN5G	Strong	Biomarker	[30]
Pyropoikilocytosis, hereditary	DISZGN3B	Strong	Biomarker	[22]
Relapsing-remitting multiple sclerosis	DISSXFCF	Strong	Biomarker	[31]
Tauopathy	DISY2IPA	Strong	Biomarker	[32]
Uterine fibroids	DISBZRMJ	Strong	Altered Expression	[23]
Intellectual disability	DISMBNXP	moderate	Biomarker	[33]
Null syndrome	DISNL62C	Supportive	X-linked	[34]
Pelizaeus-Merzbacher disease in female carriers	DIS3M7XW	Supportive	X-linked	[34]
Pelizaeus-Merzbacher disease, classic form	DISMKMY7	Supportive	X-linked	[34]
Pelizaeus-Merzbacher disease, connatal form	DISWNS6M	Supportive	X-linked	[34]
Pelizaeus-Merzbacher disease, transitional form	DISOSUNU	Supportive	X-linked	[34]
Leukodystrophy	DISVY1TT	Limited	Genetic Variation	[35]
Lysosomal storage disease	DIS6QM6U	Limited	Biomarker	[36]
Matthew-Wood syndrome	DISA7HR7	Limited	Genetic Variation	[37]
Melanoma	DIS1RRCY	Limited	Biomarker	[38]
Neoplasm	DISZKGEW	Limited	Biomarker	[38]
Nervous system disease	DISJ7GGT	Limited	Genetic Variation	[39]
Toxoplasmosis	DISYP8FH	Limited	Biomarker	[40]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Etoposide	DMNH3PG	Approved	Myelin proteolipid protein (PLP1) affects the response to substance of Etoposide.	[53]
Mitomycin	DMH0ZJE	Approved	Myelin proteolipid protein (PLP1) affects the response to substance of Mitomycin.	[53]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Myelin proteolipid protein (PLP1).	[41]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Myelin proteolipid protein (PLP1).	[42]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Myelin proteolipid protein (PLP1).	[43]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Myelin proteolipid protein (PLP1).	[44]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Myelin proteolipid protein (PLP1).	[45]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Myelin proteolipid protein (PLP1).	[46]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Myelin proteolipid protein (PLP1).	[47]
Cytarabine	DMZD5QR	Approved	Cytarabine increases the expression of Myelin proteolipid protein (PLP1).	[48]
Malathion	DMXZ84M	Approved	Malathion decreases the expression of Myelin proteolipid protein (PLP1).	[49]
Permethrin	DMZ0Q1G	Approved	Permethrin decreases the expression of Myelin proteolipid protein (PLP1).	[49]
Cocaine	DMSOX7I	Approved	Cocaine decreases the expression of Myelin proteolipid protein (PLP1).	[50]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Myelin proteolipid protein (PLP1).	[51]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the expression of Myelin proteolipid protein (PLP1).	[51]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Myelin proteolipid protein (PLP1).	[41]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of Myelin proteolipid protein (PLP1).	[44]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Myelin proteolipid protein (PLP1).	[52]

References

• [1] White matter changes in the perforant path area in patients with amyotrophic lateral sclerosis.Neuropathol Appl Neurobiol. 2019 Oct;45(6):570-585. doi: 10.1111/nan.12555. Epub 2019 May 14.
• [2] X linked spastic paraplegia (SPG2): clinical heterogeneity at a single gene locus. J Med Genet. 1993 May;30(5):381-4. doi: 10.1136/jmg.30.5.381.
• [3] Ornithine Decarboxylase Inhibition: A Strategy to Combat Various Diseases.Mini Rev Med Chem. 2018;18(12):1008-1021. doi: 10.2174/1389557517666170927130526.
• [4] MiR-146a promotes oligodendrocyte progenitor cell differentiation and enhances remyelination in a model of experimental autoimmune encephalomyelitis.Neurobiol Dis. 2019 May;125:154-162. doi: 10.1016/j.nbd.2019.01.019. Epub 2019 Jan 29.
• [5] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [6] Primary progressive multiple sclerosis as a phenotype of a PLP1 gene mutation.Ann Neurol. 2005 Sep;58(3):470-3. doi: 10.1002/ana.20601.
• [7] Cancer Characteristic Gene Selection via Sample Learning Based on Deep Sparse Filtering.Sci Rep. 2018 May 29;8(1):8270. doi: 10.1038/s41598-018-26666-0.
• [8] Multiscale network modeling of oligodendrocytes reveals molecular components of myelin dysregulation in Alzheimer's disease.Mol Neurodegener. 2017 Nov 6;12(1):82. doi: 10.1186/s13024-017-0219-3.
• [9] Expression of oligodendrocyte-associated genes in cell lines derived from human gliomas and neuroblastomas.Cancer Res. 1993 Jan 1;53(1):170-5.
• [10] Large-scale methylation domains mark a functional subset of neuronally expressed genes.Genome Res. 2011 Oct;21(10):1583-91. doi: 10.1101/gr.119131.110. Epub 2011 Jul 22.
• [11] Integrative proteomics, genomics, and translational immunology approaches reveal mutated forms of Proteolipid Protein 1 (PLP1) and mutant-specific immune response in multiple sclerosis.Proteomics. 2017 Mar;17(6). doi: 10.1002/pmic.201600322.
• [12] Identification of proteolipid protein 1 gene duplication by multiplex ligation-dependent probe amplification: first report of genetically confirmed family of Pelizaeus-Merzbacher disease in Korea.J Korean Med Sci. 2008 Apr;23(2):328-31. doi: 10.3346/jkms.2008.23.2.328.
• [13] Homocysteine, B vitamins, and vascular-access thrombosis in patients treated with hemodialysis.Am J Kidney Dis. 1998 Sep;32(3):475-81. doi: 10.1053/ajkd.1998.v32.pm9740165.
• [14] Colitis promotes neuronal differentiation of Sox2+ and PLP1+ enteric cells.Sci Rep. 2017 May 31;7(1):2525. doi: 10.1038/s41598-017-02890-y.
• [15] Adult-onset neurodegenerative disorder due to proteolipid protein gene mutation in the mother of a man with Pelizaeus-Merzbacher disease.Neurology. 1996 Nov;47(5):1333-5. doi: 10.1212/wnl.47.5.1333.
• [16] Peripheral neuropathy caused by proteolipid protein gene mutations.Ann N Y Acad Sci. 1999 Sep 14;883:351-65.
• [17] Genotype-phenotype correlation in inherited brain myelination defects due to proteolipid protein gene mutations. Clinical European Network on Brain Dysmyelinating Disease.Eur J Hum Genet. 2000 Nov;8(11):837-45. doi: 10.1038/sj.ejhg.5200537.
• [18] The P(II)-NAGK-PipX-NtcA Regulatory Axis of Cyanobacteria: A Tale of Changing Partners, Allosteric Effectors and Non-covalent Interactions.Front Mol Biosci. 2018 Nov 13;5:91. doi: 10.3389/fmolb.2018.00091. eCollection 2018.
• [19] MeCP2 Differentially Regulate the Myelin MBP and PLP Protein Expression in Oligodendrocytes and C6 Glioma.J Mol Neurosci. 2018 Jul;65(3):343-350. doi: 10.1007/s12031-018-1112-4. Epub 2018 Jul 10.
• [20] Teriflunomide attenuates neuroinflammation-related neural damage in mice carrying human PLP1 mutations.J Neuroinflammation. 2018 Jul 3;15(1):194. doi: 10.1186/s12974-018-1228-z.
• [21] Novel mutations in the GJC2 gene associated with Pelizaeus-Merzbacher-like disease.Mol Biol Rep. 2019 Aug;46(4):4507-4516. doi: 10.1007/s11033-019-04906-4. Epub 2019 Jul 3.
• [22] HYPOPHOSPHATASIA: CLINICAL ASSESSMENT AND MANAGEMENT IN THE ADULT PATIENT-A NARRATIVE REVIEW.Endocr Pract. 2018 Dec;24(12):1086-1092. doi: 10.4158/EP-2018-0194. Epub 2018 Oct 5.
• [23] Differential gene expression in uterine leiomyoma.J Lab Clin Med. 2003 May;141(5):297-308. doi: 10.1016/S0022-2143(03)00007-6.
• [24] Oligodendrocyte morphometry and expression of myelin - Related mRNA in ventral prefrontal white matter in major depressive disorder.J Psychiatr Res. 2015 Jun;65:53-62. doi: 10.1016/j.jpsychires.2015.04.010. Epub 2015 Apr 20.
• [25] Different mutations in the same codon of the proteolipid protein gene, PLP, may help in correlating genotype with phenotype in Pelizaeus-Merzbacher disease/X-linked spastic paraplegia (PMD/SPG2).Am J Med Genet. 1999 Jan 15;82(2):132-9. doi: 10.1002/(sici)1096-8628(19990115)82:2<132::aid-ajmg6>3.0.co;2-4.
• [26] Mitochondrial disease genetics update: recent insights into the molecular diagnosis and expanding phenotype of primary mitochondrial disease.Curr Opin Pediatr. 2018 Dec;30(6):714-724. doi: 10.1097/MOP.0000000000000686.
• [27] Coping with Phantom Limb Pain.Mol Neurobiol. 2018 Jan;55(1):70-84. doi: 10.1007/s12035-017-0718-9.
• [28] PLP1 splicing abnormalities identified in Pelizaeus-Merzbacher disease and SPG2 fibroblasts are associated with different types of mutations. Hum Mutat. 2008 Aug;29(8):1028-36. doi: 10.1002/humu.20758.
• [29] Epidemiological, clinical, and genetic landscapes of hypomyelinating leukodystrophies.J Neurol. 2014 Apr;261(4):752-8. doi: 10.1007/s00415-014-7263-5. Epub 2014 Feb 16.
• [30] Myelinating Glia-Specific Deletion of Fbxo7 in Mice Triggers Axonal Degeneration in the Central Nervous System Together with Peripheral Neuropathy.J Neurosci. 2019 Jul 10;39(28):5606-5626. doi: 10.1523/JNEUROSCI.3094-18.2019. Epub 2019 May 13.
• [31] Leptin increase in multiple sclerosis associates with reduced number of CD4(+)CD25+ regulatory T cells.Proc Natl Acad Sci U S A. 2005 Apr 5;102(14):5150-5. doi: 10.1073/pnas.0408995102. Epub 2005 Mar 23.
• [32] Involvement of Oligodendrocytes in Tau Seeding and Spreading in Tauopathies.Front Aging Neurosci. 2019 May 28;11:112. doi: 10.3389/fnagi.2019.00112. eCollection 2019.
• [33] A microdeletion at Xq22.2 implicates a glycine receptor GLRA4 involved in intellectual disability, behavioral problems and craniofacial anomalies. BMC Neurol. 2016 Aug 9;16:132. doi: 10.1186/s12883-016-0642-z.
• [34] PLP1 Disorders. 1999 Jun 15 [updated 2019 Dec 19]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
• [35] The wmN1 Enhancer Region of the Mouse Myelin Proteolipid Protein Gene (mPlp1) is Indispensable for Expression of an mPlp1-lacZ Transgene in Both the CNS and PNS.Neurochem Res. 2020 Mar;45(3):663-671. doi: 10.1007/s11064-019-02919-w. Epub 2019 Nov 28.
• [36] Pelizaeus-Merzbacher disease. The Lwenberg-Hill type.Acta Neuropathol. 1985;67(3-4):177-89. doi: 10.1007/BF00687799.
• [37] Oxidative stress and mitochondrial dynamics malfunction are linked in Pelizaeus-Merzbacher disease.Brain Pathol. 2018 Sep;28(5):611-630. doi: 10.1111/bpa.12571. Epub 2017 Dec 26.
• [38] (131)I-Traced PLGA-Lipid Nanoparticles as Drug Delivery Carriers for the Targeted Chemotherapeutic Treatment of Melanoma.Nanoscale Res Lett. 2017 Dec;12(1):365. doi: 10.1186/s11671-017-2140-7. Epub 2017 May 19.
• [39] Xq22 deletions and correlation with distinct neurological disease traits in females: Further evidence for a contiguous gene syndrome.Hum Mutat. 2020 Jan;41(1):150-168. doi: 10.1002/humu.23902. Epub 2019 Nov 14.
• [40] Immuno-efficacy of DNA vaccines encoding PLP1 and ROP18 against experimental Toxoplasma gondii infection in mice.Exp Parasitol. 2018 May;188:73-78. doi: 10.1016/j.exppara.2018.04.003. Epub 2018 Apr 4.
• [41] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [42] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [43] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [44] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [45] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [46] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [47] Gene expression signatures after ethanol exposure in differentiating embryoid bodies. Toxicol In Vitro. 2018 Feb;46:66-76.
• [48] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [49] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [50] Transcriptional profiling in the human prefrontal cortex: evidence for two activational states associated with cocaine abuse. Pharmacogenomics J. 2003;3(1):27-40.
• [51] Caffeine overcomes genistein-induced G2/M cell cycle arrest in breast cancer cells. Nutr Cancer. 2008;60(3):382-8.
• [52] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [53] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.