Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT90NSLI)

• DOT Name: Bcl-2-modifying factor (BMF)
• Gene Name: BMF
• Related Disease:
  Amyloidosis
  Autoimmune disease
  B-cell neoplasm
  Breast cancer
  Breast carcinoma
  Childhood acute lymphoblastic leukemia
  Cholelithiasis
  Classic Hodgkin lymphoma
  Colorectal carcinoma
  Esophageal squamous cell carcinoma
  Fanconi anemia complementation group A
  Fanconi's anemia
  Myelofibrosis
  Neoplasm
  Non-small-cell lung cancer
  Plasma cell myeloma
  Primary myelofibrosis
  Advanced cancer
  Rhabdomyosarcoma
  Small lymphocytic lymphoma
  Type-1/2 diabetes
  Adult lymphoma
  Chronic obstructive pulmonary disease
  Lymphoma
  Pediatric lymphoma
• UniProt ID: BMF_HUMAN
• PDB ID: 7CNU; 8IQK; 8IQL
• Pfam ID: PF15185
• Sequence:
  MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
  RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP
  PEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNG
  AGPR
• Function: May play a role in apoptosis. Isoform 1 seems to be the main initiator.
• Tissue Specificity: Isoform 1 is mainly expressed in B-lymphoid cells. Isoform 2 and isoform 3 are mainly expressed in B-CLL and normal B-cells.
• KEGG Pathway: MicroR.s in cancer (hsa05206)
• Reactome Pathway:
  Activation of BMF and translocation to mitochondria (R-HSA-139910)
  BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members (R-HSA-111453)

Molecular Interaction Atlas (MIA) of This DOT

25 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Amyloidosis	DISHTAI2	Strong	Biomarker	[1]
Autoimmune disease	DISORMTM	Strong	Biomarker	[1]
B-cell neoplasm	DISVY326	Strong	Genetic Variation	[2]
Breast cancer	DIS7DPX1	Strong	Biomarker	[3]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[3]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Biomarker	[4]
Cholelithiasis	DISERLZB	Strong	Altered Expression	[5]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Genetic Variation	[6]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[7]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[8]
Fanconi anemia complementation group A	DIS8PZLI	Strong	Biomarker	[9]
Fanconi's anemia	DISGW6Q8	Strong	Biomarker	[9]
Myelofibrosis	DISIMP21	Strong	Genetic Variation	[10]
Neoplasm	DISZKGEW	Strong	Biomarker	[11]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[12]
Plasma cell myeloma	DIS0DFZ0	Strong	Genetic Variation	[6]
Primary myelofibrosis	DIS6L0CN	Strong	Genetic Variation	[10]
Advanced cancer	DISAT1Z9	moderate	Genetic Variation	[13]
Rhabdomyosarcoma	DISNR7MS	moderate	Biomarker	[11]
Small lymphocytic lymphoma	DIS30POX	moderate	Genetic Variation	[6]
Type-1/2 diabetes	DISIUHAP	moderate	Biomarker	[14]
Adult lymphoma	DISK8IZR	Limited	Biomarker	[15]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Biomarker	[16]
Lymphoma	DISN6V4S	Limited	Biomarker	[15]
Pediatric lymphoma	DIS51BK2	Limited	Biomarker	[15]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Bcl-2-modifying factor (BMF).	[17]

33 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Bcl-2-modifying factor (BMF).	[18]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Bcl-2-modifying factor (BMF).	[19]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Bcl-2-modifying factor (BMF).	[20]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Bcl-2-modifying factor (BMF).	[21]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Bcl-2-modifying factor (BMF).	[22]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Bcl-2-modifying factor (BMF).	[23]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Bcl-2-modifying factor (BMF).	[24]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Bcl-2-modifying factor (BMF).	[25]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Bcl-2-modifying factor (BMF).	[26]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Bcl-2-modifying factor (BMF).	[27]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Bcl-2-modifying factor (BMF).	[28]
Aspirin	DM672AH	Approved	Aspirin increases the expression of Bcl-2-modifying factor (BMF).	[29]
Menthol	DMG2KW7	Approved	Menthol decreases the expression of Bcl-2-modifying factor (BMF).	[30]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of Bcl-2-modifying factor (BMF).	[31]
Fenofibrate	DMFKXDY	Approved	Fenofibrate increases the expression of Bcl-2-modifying factor (BMF).	[32]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil decreases the expression of Bcl-2-modifying factor (BMF).	[31]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Bcl-2-modifying factor (BMF).	[33]
Pracinostat	DMTD7AB	Phase 3	Pracinostat increases the expression of Bcl-2-modifying factor (BMF).	[26]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Bcl-2-modifying factor (BMF).	[34]
GSK2110183	DMZHB37	Phase 2	GSK2110183 increases the expression of Bcl-2-modifying factor (BMF).	[35]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Bcl-2-modifying factor (BMF).	[36]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Bcl-2-modifying factor (BMF).	[37]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Bcl-2-modifying factor (BMF).	[38]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Bcl-2-modifying factor (BMF).	[39]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Bcl-2-modifying factor (BMF).	[26]
PIRINIXIC ACID	DM82Y75	Preclinical	PIRINIXIC ACID increases the expression of Bcl-2-modifying factor (BMF).	[40]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Bcl-2-modifying factor (BMF).	[41]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Bcl-2-modifying factor (BMF).	[42]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Bcl-2-modifying factor (BMF).	[22]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Bcl-2-modifying factor (BMF).	[43]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Bcl-2-modifying factor (BMF).	[44]
Propanoic Acid	DM9TN2W	Investigative	Propanoic Acid increases the expression of Bcl-2-modifying factor (BMF).	[45]
Octanedioic acid bis-hydroxyamide	DMJNQ9K	Investigative	Octanedioic acid bis-hydroxyamide increases the expression of Bcl-2-modifying factor (BMF).	[26]

References

• [1] The pro-apoptotic protein Bmf co-operates with Bim and Puma in neuron death induced by -amyloid or NGF deprivation.Mol Cell Neurosci. 2018 Apr;88:249-257. doi: 10.1016/j.mcn.2018.02.011. Epub 2018 Feb 27.
• [2] Genetic Predisposition to Chronic Lymphocytic Leukemia Is Mediated by a BMF Super-Enhancer Polymorphism.Cell Rep. 2016 Aug 23;16(8):2061-2067. doi: 10.1016/j.celrep.2016.07.053. Epub 2016 Aug 11.
• [3] Restraining FOXO3-dependent transcriptional BMF activation underpins tumour growth and metastasis of E-cadherin-negative breast cancer.Cell Death Differ. 2016 Sep 1;23(9):1483-92. doi: 10.1038/cdd.2016.33. Epub 2016 Apr 1.
• [4] Response to glucocorticoids and toxicity in childhood acute lymphoblastic leukemia: role of polymorphisms of genes involved in glucocorticoid response.Pediatr Blood Cancer. 2009 Dec;53(6):984-91. doi: 10.1002/pbc.22163.
• [5] Gene expression profiling reveals upregulated UCA1 and BMF in gallbladder epithelia of children with pancreaticobiliary maljunction.J Pediatr Gastroenterol Nutr. 2011 Jun;52(6):744-50. doi: 10.1097/MPG.0b013e318214bd30.
• [6] Genome-wide association analysis of chronic lymphocytic leukaemia, Hodgkin lymphoma and multiple myeloma identifies pleiotropic risk loci.Sci Rep. 2017 Jan 23;7:41071. doi: 10.1038/srep41071.
• [7] Reciprocal regulation of BMF and BIRC5 (Survivin) linked to Eomes overexpression in colorectal cancer.Cancer Lett. 2016 Oct 28;381(2):341-8. doi: 10.1016/j.canlet.2016.08.008. Epub 2016 Aug 15.
• [8] MicroRNA-125b inhibits cell proliferation and induces cell apoptosis in esophageal squamous cell carcinoma by targeting BMF.Oncol Rep. 2018 Jul;40(1):61-72. doi: 10.3892/or.2018.6413. Epub 2018 May 2.
• [9] Hematopoietic cell transplantation in Fanconi anemia: current evidence, challenges and recommendations.Expert Rev Hematol. 2017 Jan;10(1):81-97. doi: 10.1080/17474086.2016.1268048. Epub 2016 Dec 21.
• [10] Transforming growth factor - and interleukin 13-producing mast cells are associated with fibrosis in bone marrow.Hum Pathol. 2017 Apr;62:180-186. doi: 10.1016/j.humpath.2017.01.007. Epub 2017 Jan 31.
• [11] NRAS-Mutated Rhabdomyosarcoma Cells Are Vulnerable to Mitochondrial Apoptosis Induced by Coinhibition of MEK and PI3K.Cancer Res. 2018 Apr 15;78(8):2000-2013. doi: 10.1158/0008-5472.CAN-17-1737. Epub 2018 Feb 6.
• [12] Antitumor effect of miR-197 targeting in p53 wild-type lung cancer.Cell Death Differ. 2014 May;21(5):774-82. doi: 10.1038/cdd.2014.6. Epub 2014 Jan 31.
• [13] Mutant p53-R273H mediates cancer cell survival and anoikis resistance through AKT-dependent suppression of BCL2-modifying factor (BMF).Cell Death Dis. 2015 Jul 16;6(7):e1826. doi: 10.1038/cddis.2015.191.
• [14] Bcl-2-modifying factor induces renal proximal tubular cell apoptosis in diabetic mice.Diabetes. 2012 Feb;61(2):474-84. doi: 10.2337/db11-0141. Epub 2011 Dec 30.
• [15] Concise Review: Cheating Death for a Better Transplant.Stem Cells. 2018 Nov;36(11):1646-1654. doi: 10.1002/stem.2901. Epub 2018 Oct 1.
• [16] Risk of COPD due to indoor air pollution from biomass cooking fuel: a systematic review and meta-analysis.Int J Environ Health Res. 2020 Feb;30(1):75-88. doi: 10.1080/09603123.2019.1575951. Epub 2019 Feb 13.
• [17] Nuclear and Mitochondrial DNA Methylation Patterns Induced by Valproic Acid in Human Hepatocytes. Chem Res Toxicol. 2017 Oct 16;30(10):1847-1854. doi: 10.1021/acs.chemrestox.7b00171. Epub 2017 Sep 13.
• [18] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [19] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [20] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [21] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [22] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [23] Darinaparsin induces a unique cellular response and is active in an arsenic trioxide-resistant myeloma cell line. Mol Cancer Ther. 2009 May;8(5):1197-206.
• [24] Vorinostat-induced apoptosis in mantle cell lymphoma is mediated by acetylation of proapoptotic BH3-only gene promoters. Clin Cancer Res. 2011 Jun 15;17(12):3956-68. doi: 10.1158/1078-0432.CCR-10-3412. Epub 2011 Jun 7.
• [25] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [26] Development and validation of the TGx-HDACi transcriptomic biomarker to detect histone deacetylase inhibitors in human TK6 cells. Arch Toxicol. 2021 May;95(5):1631-1645. doi: 10.1007/s00204-021-03014-2. Epub 2021 Mar 26.
• [27] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [28] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [29] Aspirin induces apoptosis in human leukemia cells independently of NF-kappaB and MAPKs through alteration of the Mcl-1/Noxa balance. Apoptosis. 2010 Feb;15(2):219-29. doi: 10.1007/s10495-009-0424-9.
• [30] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [31] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [32] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [33] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [34] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [35] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [36] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [37] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [38] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [39] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [40] PPAR-mediated responses in human adult liver stem cells: In vivo/in vitro and cross-species comparisons. J Steroid Biochem Mol Biol. 2013 Nov;138:236-47. doi: 10.1016/j.jsbmb.2013.06.004. Epub 2013 Jun 27.
• [41] Comparative Analysis of Transcriptomic Changes including mRNA and microRNA Expression Induced by the Xenoestrogens Zearalenone and Bisphenol A in Human Ovarian Cells. Toxins (Basel). 2023 Feb 9;15(2):140. doi: 10.3390/toxins15020140.
• [42] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [43] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [44] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [45] Propionic acid induces mitochondrial dysfunction and affects gene expression for mitochondria biogenesis and neuronal differentiation in SH-SY5Y cell line. Neurotoxicology. 2019 Dec;75:116-122. doi: 10.1016/j.neuro.2019.09.009. Epub 2019 Sep 14.