Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9KBH7C)

• DOT Name: C-type lectin domain family 11 member A (CLEC11A)
• Synonyms: C-type lectin superfamily member 3; Lymphocyte secreted C-type lectin; Osteolectin; Stem cell growth factor; p47
• Gene Name: CLEC11A
• Related Disease:
  Carotid stenosis
  Adult T-cell leukemia/lymphoma
  Anemia
  Chronic granulomatous disease
  Chronic inflammatory demyelinating polyneuropathy
  Epithelial ovarian cancer
  Human T-lymphotropic virus 1 infectious disease
  Immunodeficiency
  Knee osteoarthritis
  leukaemia
  Leukemia
  Malignant mesothelioma
  Multiple sclerosis
  Osteoporosis
  Ovarian cancer
  Ovarian neoplasm
  Piebaldism
  Plasmodium falciparum malaria
  Systemic mastocytosis
  Vibrio cholerae infection
  Advanced cancer
  Gastrointestinal stromal tumour
  Hepatocellular carcinoma
  Neoplasm
  Sarcoma
  Soft tissue sarcoma
  Asthma
  Malaria
  Type-1/2 diabetes
• UniProt ID: CLC11_HUMAN
• Pfam ID: PF00059
• Sequence:
  MQAAWLLGALVVPQLLGFGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAG
  RGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDA
  GLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKG
  LRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWL
  GVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQA
  SDDGSWWDHDCQRRLYYVCEFPF
• Function: Promotes osteogenesis by stimulating the differentiation of mesenchymal progenitors into mature osteoblasts. Important for repair and maintenance of adult bone.
• Tissue Specificity: Expressed in skeletal tissues including bone marrow, chondrocytes, primary ossification center-associated cells, the perichondrium and periosteum. Lower levels of expression were detected in spleen, thymus, appendix and fetal liver.

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Carotid stenosis	DISZA8D0	Definitive	Biomarker	[1]
Adult T-cell leukemia/lymphoma	DIS882XU	Strong	Altered Expression	[2]
Anemia	DISTVL0C	Strong	Biomarker	[3]
Chronic granulomatous disease	DIS9ZR24	Strong	Genetic Variation	[4]
Chronic inflammatory demyelinating polyneuropathy	DISNGBLD	Strong	Altered Expression	[5]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[6]
Human T-lymphotropic virus 1 infectious disease	DISN5C4M	Strong	Biomarker	[2]
Immunodeficiency	DIS093I0	Strong	Biomarker	[7]
Knee osteoarthritis	DISLSNBJ	Strong	Genetic Variation	[8]
leukaemia	DISS7D1V	Strong	Genetic Variation	[9]
Leukemia	DISNAKFL	Strong	Genetic Variation	[9]
Malignant mesothelioma	DISTHJGH	Strong	Biomarker	[10]
Multiple sclerosis	DISB2WZI	Strong	Altered Expression	[5]
Osteoporosis	DISF2JE0	Strong	Biomarker	[11]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[6]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[6]
Piebaldism	DISDLDF2	Strong	Biomarker	[12]
Plasmodium falciparum malaria	DIS3Q9KF	Strong	Biomarker	[3]
Systemic mastocytosis	DISNQ2OY	Strong	Genetic Variation	[9]
Vibrio cholerae infection	DISW7E3U	Strong	Biomarker	[13]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[14]
Gastrointestinal stromal tumour	DIS6TJYS	moderate	Altered Expression	[15]
Hepatocellular carcinoma	DIS0J828	moderate	Altered Expression	[16]
Neoplasm	DISZKGEW	moderate	Biomarker	[15]
Sarcoma	DISZDG3U	moderate	Altered Expression	[17]
Soft tissue sarcoma	DISSN8XB	moderate	Altered Expression	[17]
Asthma	DISW9QNS	Limited	Altered Expression	[18]
Malaria	DISQ9Y50	Limited	Biomarker	[19]
Type-1/2 diabetes	DISIUHAP	Limited	Altered Expression	[20]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of C-type lectin domain family 11 member A (CLEC11A).	[21]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of C-type lectin domain family 11 member A (CLEC11A).	[22]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of C-type lectin domain family 11 member A (CLEC11A).	[23]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of C-type lectin domain family 11 member A (CLEC11A).	[24]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of C-type lectin domain family 11 member A (CLEC11A).	[25]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of C-type lectin domain family 11 member A (CLEC11A).	[26]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of C-type lectin domain family 11 member A (CLEC11A).	[27]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of C-type lectin domain family 11 member A (CLEC11A).	[28]
Paclitaxel	DMLB81S	Approved	Paclitaxel increases the expression of C-type lectin domain family 11 member A (CLEC11A).	[29]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of C-type lectin domain family 11 member A (CLEC11A).	[30]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of C-type lectin domain family 11 member A (CLEC11A).	[32]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of C-type lectin domain family 11 member A (CLEC11A).	[34]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of C-type lectin domain family 11 member A (CLEC11A).	[31]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of C-type lectin domain family 11 member A (CLEC11A).	[33]

References

• [1] Elevated levels of endothelial-derived microparticles, and serum CXCL9 and SCGF- are associated with unstable asymptomatic carotid plaques.Sci Rep. 2015 Nov 13;5:16658. doi: 10.1038/srep16658.
• [2] Degradation of p47 by autophagy contributes to CADM1 overexpression in ATLL cells through the activation of NF-B.Sci Rep. 2019 Mar 5;9(1):3491. doi: 10.1038/s41598-019-39424-7.
• [3] A novel functional variant in the stem cell growth factor promoter protects against severe malarial anemia.Infect Immun. 2010 Jan;78(1):453-60. doi: 10.1128/IAI.00895-09. Epub 2009 Nov 2.
• [4] Aberrant [correction of Abberant] cytosolic calcium ion mobilization in chronic granulomatous disease neutrophils.Inflammation. 2004 Jun;28(3):133-8. doi: 10.1023/b:ifla.0000039559.96659.d9.
• [5] Cerebrospinal Fluid Cytokine Expression Profile in Multiple Sclerosis and Chronic Inflammatory Demyelinating Polyneuropathy.Immunol Invest. 2018 Feb;47(2):135-145. doi: 10.1080/08820139.2017.1405978. Epub 2017 Nov 28.
• [6] Expression and action of kit ligand/stem cell factor in normal human and bovine ovarian surface epithelium and ovarian cancer.Biol Reprod. 2000 Jun;62(6):1600-9. doi: 10.1095/biolreprod62.6.1600.
• [7] p47 licenses activation of the immune deficiency pathway in the tick Ixodes scapularis.Proc Natl Acad Sci U S A. 2019 Jan 2;116(1):205-210. doi: 10.1073/pnas.1808905116. Epub 2018 Dec 17.
• [8] Synovial Cytokines Significantly Correlate with Osteoarthritis-Related Knee Pain and Disability: Inflammatory Mediators of Potential Clinical Relevance.J Clin Med. 2019 Aug 29;8(9):1343. doi: 10.3390/jcm8091343.
• [9] Mast cells from different molecular and prognostic subtypes of systemic mastocytosis display distinct immunophenotypes.J Allergy Clin Immunol. 2010 Mar;125(3):719-26, 726.e1-726.e4. doi: 10.1016/j.jaci.2009.10.020. Epub 2010 Jan 12.
• [10] Increased levels of C-C chemokine RANTES in asbestos exposed workers and in malignant mesothelioma patients from an hyperendemic area.PLoS One. 2014 Aug 27;9(8):e104848. doi: 10.1371/journal.pone.0104848. eCollection 2014.
• [11] Clec11a/osteolectin is an osteogenic growth factor that promotes the maintenance of the adult skeleton.Elife. 2016 Dec 13;5:e18782. doi: 10.7554/eLife.18782.
• [12] The molecular genetics of albinism and piebaldism.Arch Dermatol. 1994 Mar;130(3):355-8.
• [13] A Recombinant 47-kDa Outer Membrane Protein Induces an Immune Response against Orientia tsutsugamushi Strain Boryong.Am J Trop Med Hyg. 2017 Jul;97(1):30-37. doi: 10.4269/ajtmh.15-0771.
• [14] Loss of the eukaryotic initiation factor 3f in melanoma.Mol Carcinog. 2008 Oct;47(10):806-13. doi: 10.1002/mc.20436.
• [15] Proteomic detection of a large amount of SCGF in the stroma of GISTs after imatinib therapy.J Transl Med. 2011 Sep 23;9:158. doi: 10.1186/1479-5876-9-158.
• [16] Hepatocellular Carcinoma Detection by Plasma Methylated DNA: Discovery, Phase I Pilot, and Phase II Clinical Validation.Hepatology. 2019 Mar;69(3):1180-1192. doi: 10.1002/hep.30244. Epub 2019 Feb 5.
• [17] Clinical Benefit of Pazopanib in a Patient with Metastatic Chondrosarcoma: A Case Report and Review of the Literature.Front Oncol. 2018 Mar 1;8:45. doi: 10.3389/fonc.2018.00045. eCollection 2018.
• [18] Serum level of stem cell factor and its soluble receptor in aspirin-exacerbated respiratory disease.Immunotherapy. 2019 Oct;11(15):1283-1291. doi: 10.2217/imt-2019-0042. Epub 2019 Sep 18.
• [19] Plasmodium P47: a key gene for malaria transmission by mosquito vectors.Curr Opin Microbiol. 2017 Dec;40:168-174. doi: 10.1016/j.mib.2017.11.029. Epub 2017 Dec 8.
• [20] Euterpe oleracea Mart. seed extract protects against renal injury in diabetic and spontaneously hypertensive rats: role of inflammation and oxidative stress.Eur J Nutr. 2018 Mar;57(2):817-832. doi: 10.1007/s00394-016-1371-1. Epub 2017 Jan 20.
• [21] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [22] Gene alterations of ovarian cancer cells expressing estrogen receptors by estrogen and bisphenol a using microarray analysis. Lab Anim Res. 2011 Jun;27(2):99-107. doi: 10.5625/lar.2011.27.2.99. Epub 2011 Jun 22.
• [23] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [24] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [25] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [26] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [27] Dissecting progressive stages of 5-fluorouracil resistance in vitro using RNA expression profiling. Int J Cancer. 2004 Nov 1;112(2):200-12. doi: 10.1002/ijc.20401.
• [28] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [29] Identification of selective inhibitors of cancer stem cells by high-throughput screening. Cell. 2009 Aug 21;138(4):645-659. doi: 10.1016/j.cell.2009.06.034. Epub 2009 Aug 13.
• [30] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [31] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [32] The genome-wide expression profile of Scrophularia ningpoensis-treated thapsigargin-stimulated U-87MG cells. Neurotoxicology. 2009 May;30(3):368-76.
• [33] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [34] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.