Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB4U1HY)

• DOT Name: StAR-related lipid transfer protein 13 (STARD13)
• Synonyms: 46H23.2; Deleted in liver cancer 2 protein; DLC-2; Rho GTPase-activating protein; START domain-containing protein 13; StARD13
• Gene Name: STARD13
• Related Disease:
  Advanced cancer
  Astrocytoma
  Breast cancer
  Breast carcinoma
  Carcinoma
  Carcinoma of liver and intrahepatic biliary tract
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Cystic fibrosis
  Endometrial cancer
  Endometrial carcinoma
  Glioma
  Hepatocellular carcinoma
  Linear skin defects with multiple congenital anomalies 1
  Liver cancer
  Neoplasm
  Non-small-cell lung cancer
  Prostate cancer
  Prostate carcinoma
  Spinal muscular atrophy
  Kidney cancer
  Nasopharyngeal carcinoma
  Renal carcinoma
  Intellectual disability
  Bone osteosarcoma
  Osteosarcoma
  Rectal carcinoma
  Rectal neoplasm
  Schizophrenia
• UniProt ID: STA13_HUMAN
• PDB ID: 2H80; 2JW2; 2PSO
• Pfam ID: PF00620 ; PF07647 ; PF01852
• Sequence:
  MFSQVPRTPASGCYYLNSMTPEGQEMYLRFDQTTRRSPYRMSRILARHQLVTKIQQEIEA
  KEACDWLRAAGFPQYAQLYEDSQFPINIVAVKNDHDFLEKDLVEPLCRRLNTLNKCASMK
  LDVNFQRKKGDDSDEEDLCISNKWTFQRTSRRWSRVDDLYTLLPRGDRNGSPGGTGMRNT
  TSSESVLTDLSEPEVCSIHSESSGGSDSRSQPGQCCTDNPVMLDAPLVSSSLPQPPRDVL
  NHPFHPKNEKPTRARAKSFLKRMETLRGKGAHGRHKGSGRTGGLVISGPMLQQEPESFKA
  MQCIQIPNGDLQNSPPPACRKGLPCSGKSSGESSPSEHSSSGVSTPCLKERKCHEANKRG
  GMYLEDLDVLAGTALPDAGDQSRMHEFHSQENLVVHIPKDHKPGTFPKALSIESLSPTDS
  SNGVNWRTGSISLGREQVPGAREPRLMASCHRASRVSIYDNVPGSHLYASTGDLLDLEKD
  DLFPHLDDILQHVNGLQEVVDDWSKDVLPELQTHDTLVGEPGLSTFPSPNQITLDFEGNS
  VSEGRTTPSDVERDVTSLNESEPPGVRDRRDSGVGASLTRPNRRLRWNSFQLSHQPRPAP
  ASPHISSQTASQLSLLQRFSLLRLTAIMEKHSMSNKHGWTWSVPKFMKRMKVPDYKDKAV
  FGVPLIVHVQRTGQPLPQSIQQALRYLRSNCLDQVGLFRKSGVKSRIHALRQMNENFPEN
  VNYEDQSAYDVADMVKQFFRDLPEPLFTNKLSETFLHIYQYVSKEQRLQAVQAAILLLAD
  ENREVLQTLLCFLNDVVNLVEENQMTPMNLAVCLAPSLFHLNLLKKESSPRVIQKKYATG
  KPDQKDLNENLAAAQGLAHMIMECDRLFEVPHELVAQSRNSYVEAEIHVPTLEELGTQLE
  ESGATFHTYLNHLIQGLQKEAKEKFKGWVTCSSTDNTDLAFKKVGDGNPLKLWKASVEVE
  APPSVVLNRVLRERHLWDEDFVQWKVVETLDRQTEIYQYVLNSMAPHPSRDFVVLRTWKT
  DLPKGMCTLVSLSVEHEEAQLLGGVRAVVMDSQYLIEPCGSGKSRLTHICRIDLKGHSPE
  WYSKGFGHLCAAEVARIRNSFQPLIAEGPETKI
• Function: GTPase-activating protein for RhoA, and perhaps for Cdc42. May be involved in regulation of cytoskeletal reorganization, cell proliferation and cell motility. Acts a tumor suppressor in hepatocellular carcinoma cells.
• Tissue Specificity: Ubiquitously expressed. Underexpressed in hepatocellular carcinoma cells and some breast cancer cell lines.
• Reactome Pathway:
  RHOB GTPase cycle (R-HSA-9013026)
  RHOC GTPase cycle (R-HSA-9013106)
  CDC42 GTPase cycle (R-HSA-9013148)
  RHOA GTPase cycle (R-HSA-8980692)

Molecular Interaction Atlas (MIA) of This DOT

30 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Astrocytoma	DISL3V18	Strong	Biomarker	[2]
Breast cancer	DIS7DPX1	Strong	Biomarker	[1]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[1]
Carcinoma	DISH9F1N	Strong	Biomarker	[3]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Biomarker	[4]
Colon cancer	DISVC52G	Strong	Biomarker	[5]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[5]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[6]
Cystic fibrosis	DIS2OK1Q	Strong	Biomarker	[7]
Endometrial cancer	DISW0LMR	Strong	Genetic Variation	[8]
Endometrial carcinoma	DISXR5CY	Strong	Genetic Variation	[8]
Glioma	DIS5RPEH	Strong	Biomarker	[9]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[10]
Linear skin defects with multiple congenital anomalies 1	DISNYKBT	Strong	Biomarker	[11]
Liver cancer	DISDE4BI	Strong	Biomarker	[4]
Neoplasm	DISZKGEW	Strong	Biomarker	[12]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[13]
Prostate cancer	DISF190Y	Strong	Biomarker	[14]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[14]
Spinal muscular atrophy	DISTLKOB	Strong	Biomarker	[15]
Kidney cancer	DISBIPKM	moderate	Biomarker	[16]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Biomarker	[17]
Renal carcinoma	DISER9XT	moderate	Biomarker	[16]
Intellectual disability	DISMBNXP	Disputed	Biomarker	[18]
Bone osteosarcoma	DIST1004	Limited	Biomarker	[19]
Osteosarcoma	DISLQ7E2	Limited	Biomarker	[19]
Rectal carcinoma	DIS8FRR7	Limited	Altered Expression	[20]
Rectal neoplasm	DISB4UZ0	Limited	Altered Expression	[20]
Schizophrenia	DISSRV2N	No Known	Unknown	[21]

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of StAR-related lipid transfer protein 13 (STARD13).	[22]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of StAR-related lipid transfer protein 13 (STARD13).	[23]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of StAR-related lipid transfer protein 13 (STARD13).	[24]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of StAR-related lipid transfer protein 13 (STARD13).	[25]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of StAR-related lipid transfer protein 13 (STARD13).	[26]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of StAR-related lipid transfer protein 13 (STARD13).	[27]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of StAR-related lipid transfer protein 13 (STARD13).	[28]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of StAR-related lipid transfer protein 13 (STARD13).	[29]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of StAR-related lipid transfer protein 13 (STARD13).	[30]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of StAR-related lipid transfer protein 13 (STARD13).	[31]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of StAR-related lipid transfer protein 13 (STARD13).	[32]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of StAR-related lipid transfer protein 13 (STARD13).	[33]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of StAR-related lipid transfer protein 13 (STARD13).	[34]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of StAR-related lipid transfer protein 13 (STARD13).	[35]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of StAR-related lipid transfer protein 13 (STARD13).	[36]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of StAR-related lipid transfer protein 13 (STARD13).	[37]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of StAR-related lipid transfer protein 13 (STARD13).	[39]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of StAR-related lipid transfer protein 13 (STARD13).	[22]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of StAR-related lipid transfer protein 13 (STARD13).	[40]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of StAR-related lipid transfer protein 13 (STARD13).	[38]

References

• [1] DLC2 operates as a tumor suppressor gene in breast cancer via the RhoGTPase pathway.Oncol Lett. 2019 Feb;17(2):2107-2116. doi: 10.3892/ol.2018.9874. Epub 2018 Dec 28.
• [2] The regulation of RhoA at focal adhesions by StarD13 is important for astrocytoma cell motility.Exp Cell Res. 2014 Feb 15;321(2):109-22. doi: 10.1016/j.yexcr.2013.11.023. Epub 2013 Dec 10.
• [3] Aberrant methylation and deacetylation of deleted in liver cancer-1 gene in prostate cancer: potential clinical applications.Clin Cancer Res. 2006 Mar 1;12(5):1412-9. doi: 10.1158/1078-0432.CCR-05-1906.
• [4] Regulation of white and brown adipocyte differentiation by RhoGAP DLC1.PLoS One. 2017 Mar 30;12(3):e0174761. doi: 10.1371/journal.pone.0174761. eCollection 2017.
• [5] Effect of StarD13 on colorectal cancer proliferation, motility and invasion.Oncol Rep. 2014 Jan;31(1):505-15. doi: 10.3892/or.2013.2861. Epub 2013 Nov 20.
• [6] Evaluation of miR-720 prognostic significance in patients with colorectal cancer.Tumour Biol. 2015 Feb;36(2):719-27. doi: 10.1007/s13277-014-2697-z. Epub 2014 Oct 7.
• [7] Statin-mediated correction of STAT1 signaling and inducible nitric oxide synthase expression in cystic fibrosis epithelial cells.Am J Physiol Lung Cell Mol Physiol. 2003 Dec;285(6):L1286-95. doi: 10.1152/ajplung.00127.2003. Epub 2003 Aug 29.
• [8] Co-regulatory expression quantitative trait loci mapping: method and application to endometrial cancer.BMC Med Genomics. 2011 Jan 12;4:6. doi: 10.1186/1755-8794-4-6.
• [9] DLC2 inhibits development of glioma through regulating the expression ratio of TAp73/TAp73.Am J Cancer Res. 2018 Jul 1;8(7):1200-1213. eCollection 2018.
• [10] Deleted in Liver Cancer 2 (DLC2) protein expression in hepatocellular carcinoma.Eur J Histochem. 2019 Feb 18;63(1):2981. doi: 10.4081/ejh.2019.2981.
• [11] Functional analysis of ARHGAP6, a novel GTPase-activating protein for RhoA.Hum Mol Genet. 2000 Mar 1;9(4):477-88. doi: 10.1093/hmg/9.4.477.
• [12] DLC1 SAM domain-binding peptides inhibit cancer cell growth and migration by inactivating RhoA.J Biol Chem. 2020 Jan 10;295(2):645-656. doi: 10.1074/jbc.RA119.011929. Epub 2019 Dec 5.
• [13] High expression of DLC family proteins predicts better prognosis and inhibits tumor progression in NSCLC.Mol Med Rep. 2019 Jun;19(6):4881-4889. doi: 10.3892/mmr.2019.10146. Epub 2019 Apr 10.
• [14] Inhibition of miR-9-5p suppresses prostate cancer progress by targeting StarD13.Cell Mol Biol Lett. 2019 Mar 8;24:20. doi: 10.1186/s11658-019-0145-1. eCollection 2019.
• [15] MicroRNA-125b Promotes Hepatic Stellate Cell Activation and Liver Fibrosis by Activating RhoA Signaling.Mol Ther Nucleic Acids. 2018 Sep 7;12:57-66. doi: 10.1016/j.omtn.2018.04.016. Epub 2018 May 3.
• [16] Rho GTPase Activating Protein 24 (ARHGAP24) Silencing Promotes Lung Cancer Cell Migration and Invasion by Activating -Catenin Signaling.Med Sci Monit. 2019 Jan 1;25:21-31. doi: 10.12659/MSM.911503.
• [17] The DLC-1 -29A/T polymorphism is not associated with nasopharyngeal carcinoma risk in Chinese population.Genet Test. 2008 Sep;12(3):345-9. doi: 10.1089/gte.2007.0121.
• [18] Oligophrenin-1 regulates number, morphology and synaptic properties of adult-born inhibitory interneurons in the olfactory bulb.Hum Mol Genet. 2016 Dec 1;25(23):5198-5211. doi: 10.1093/hmg/ddw340.
• [19] RNA-binding protein PUM2 suppresses osteosarcoma progression via partly and competitively binding to STARD13 3'UTR with miRNAs.Cell Prolif. 2018 Dec;51(6):e12508. doi: 10.1111/cpr.12508. Epub 2018 Aug 7.
• [20] Expression profile of the tumor suppressor genes DLC-1 and DLC-2 in solid tumors.Int J Oncol. 2006 Nov;29(5):1127-32.
• [21] De novo mutations in schizophrenia implicate synaptic networks. Nature. 2014 Feb 13;506(7487):179-84. doi: 10.1038/nature12929. Epub 2014 Jan 22.
• [22] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [23] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [24] Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
• [25] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [26] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [27] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [28] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [29] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [30] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [31] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [32] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [33] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [34] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [35] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [36] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [37] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [38] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [39] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [40] In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.