Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBBUKQQ)

DOT Name	G1/S-specific cyclin-E2 (CCNE2)
Gene Name	CCNE2
UniProt ID	CCNE2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	8HN9
Pfam ID	PF02984 ; PF00134
Sequence	MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPP VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKK ESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELCP VTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAA LCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTH TNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH
Function	Essential for the control of the cell cycle at the late G1 and early S phase.
Tissue Specificity	According to PubMed:9858585, highest levels of expression in adult testis, thymus and brain. Lower levels in placenta, spleen and colon. Consistently elevated levels in tumor-derived cells compared to non-transformed proliferating cells. According to PubMed:9840927: low levels in thymus, prostate, brain, skeletal muscle, and kidney. Elevated levels in lung. According to PubMed:9840943 highly expressed in testis, placenta, thymus and brain. In a lesser extent in small intestine and colon.
KEGG Pathway	Cell cycle (hsa04110 ) Oocyte meiosis (hsa04114 ) p53 sig.ling pathway (hsa04115 ) PI3K-Akt sig.ling pathway (hsa04151 ) Cellular senescence (hsa04218 ) Cushing syndrome (hsa04934 ) Hepatitis B (hsa05161 ) Measles (hsa05162 ) Human papillomavirus infection (hsa05165 ) Human T-cell leukemia virus 1 infection (hsa05166 ) Epstein-Barr virus infection (hsa05169 ) Pathways in cancer (hsa05200 ) Viral carcinogenesis (hsa05203 ) MicroR.s in cancer (hsa05206 ) Prostate cancer (hsa05215 ) Small cell lung cancer (hsa05222 ) Gastric cancer (hsa05226 )
Reactome Pathway	SCF(Skp2)-mediated degradation of p27/p21 (R-HSA-187577 ) DNA Damage/Telomere Stress Induced Senescence (R-HSA-2559586 ) Association of TriC/CCT with target proteins during biosynthesis (R-HSA-390471 ) TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest (R-HSA-6804116 ) CDK-mediated phosphorylation and removal of Cdc6 (R-HSA-69017 ) Phosphorylation of proteins involved in G1/S transition by active Cyclin E (R-HSA-69200 ) Cyclin E associated events during G1/S transition (R-HSA-69202 ) Cyclin D associated events in G1 (R-HSA-69231 ) p53-Dependent G1 DNA Damage Response (R-HSA-69563 ) Defective binding of RB1 mutants to E2F1,(E2F2, E2F3) (R-HSA-9661069 ) G0 and Early G1 (R-HSA-1538133 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	G1/S-specific cyclin-E2 (CCNE2) affects the response to substance of Fluorouracil.	[57]
------------------------------------------------------------------------------------

68 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of G1/S-specific cyclin-E2 (CCNE2).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of G1/S-specific cyclin-E2 (CCNE2).	[6]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[7]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[8]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[9]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[10]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[10]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of G1/S-specific cyclin-E2 (CCNE2).	[11]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[12]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[6]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[13]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[14]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[15]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[16]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of G1/S-specific cyclin-E2 (CCNE2).	[17]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[18]
Cytarabine	DMZD5QR	Approved	Cytarabine increases the expression of G1/S-specific cyclin-E2 (CCNE2).	[19]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of G1/S-specific cyclin-E2 (CCNE2).	[20]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[21]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of G1/S-specific cyclin-E2 (CCNE2).	[11]
Amphotericin B	DMTAJQE	Approved	Amphotericin B decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[22]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of G1/S-specific cyclin-E2 (CCNE2).	[6]
Zidovudine	DM4KI7O	Approved	Zidovudine decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[23]
Ifosfamide	DMCT3I8	Approved	Ifosfamide increases the expression of G1/S-specific cyclin-E2 (CCNE2).	[6]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of G1/S-specific cyclin-E2 (CCNE2).	[6]
Ibuprofen	DM8VCBE	Approved	Ibuprofen increases the expression of G1/S-specific cyclin-E2 (CCNE2).	[6]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[24]
Colchicine	DM2POTE	Approved	Colchicine decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[25]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil increases the expression of G1/S-specific cyclin-E2 (CCNE2).	[6]
Ritonavir	DMU764S	Approved	Ritonavir decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[26]
Adenine	DMZLHKJ	Approved	Adenine decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[25]
LY2835219	DM93VBZ	Approved	LY2835219 decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[27]
Lamivudine	DMI347A	Approved	Lamivudine decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[23]
Atropine	DMEN6X7	Approved	Atropine increases the expression of G1/S-specific cyclin-E2 (CCNE2).	[28]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of G1/S-specific cyclin-E2 (CCNE2).	[29]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[30]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[31]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[32]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[33]
PX-866	DMYISJK	Phase 2	PX-866 decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[34]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of G1/S-specific cyclin-E2 (CCNE2).	[35]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[36]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[37]
AMEP	DMFELMQ	Phase 1	AMEP increases the expression of G1/S-specific cyclin-E2 (CCNE2).	[38]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[39]
Steroid derivative 1	DMB0NVQ	Patented	Steroid derivative 1 decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[40]
Harmine	DMPA5WD	Patented	Harmine increases the expression of G1/S-specific cyclin-E2 (CCNE2).	[41]
TDZD-8	DMG6Q45	Patented	TDZD-8 decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[42]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of G1/S-specific cyclin-E2 (CCNE2).	[43]
Scriptaid	DM9JZ21	Preclinical	Scriptaid affects the expression of G1/S-specific cyclin-E2 (CCNE2).	[44]
Nobiletin	DM7R3B6	Preclinical	Nobiletin decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[45]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[46]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[47]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[48]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of G1/S-specific cyclin-E2 (CCNE2).	[49]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[50]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[51]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[52]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[38]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[53]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[42]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[54]
OXYBENZONE	DMMZYX6	Investigative	OXYBENZONE increases the expression of G1/S-specific cyclin-E2 (CCNE2).	[55]
GW-3965	DMG60ET	Investigative	GW-3965 decreases the expression of G1/S-specific cyclin-E2 (CCNE2).	[56]
------------------------------------------------------------------------------------


⏷ Show the Full List of 68 Drug(s)

References

1	Effects of valproic acid and levetiracetam on viability and cell cycle regulatory genes expression in the OVCAR-3 cell line. Pharmacol Rep. 2012;64(1):157-65. doi: 10.1016/s1734-1140(12)70742-9.
2	Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
3	Retinoic acid-induced downmodulation of telomerase activity in human cancer cells. Exp Mol Pathol. 2005 Oct;79(2):108-17.
4	Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
5	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6	Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
7	Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
8	Genome-wide analysis of BEAS-2B cells exposed to trivalent arsenicals and dimethylthioarsinic acid. Toxicology. 2010 Jan 31;268(1-2):31-9.
9	Inhibition of prostate cancer cell colony formation by the flavonoid quercetin correlates with modulation of specific regulatory genes. Clin Diagn Lab Immunol. 2004 Jan;11(1):63-9. doi: 10.1128/cdli.11.1.63-69.2004.
10	Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
11	Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
12	Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
13	mTOR inhibition reverses acquired endocrine therapy resistance of breast cancer cells at the cell proliferation and gene-expression levels. Cancer Sci. 2008 Oct;99(10):1992-2003. doi: 10.1111/j.1349-7006.2008.00955.x.
14	Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
15	Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
16	Cannabidiol-induced transcriptomic changes and cellular senescence in human Sertoli cells. Toxicol Sci. 2023 Feb 17;191(2):227-238. doi: 10.1093/toxsci/kfac131.
17	In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
18	A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
19	Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
20	Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
21	Effects of paclitaxel on proliferation and apoptosis in human acute myeloid leukemia HL-60 cells. Acta Pharmacol Sin. 2004 Mar;25(3):378-84.
22	Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
23	Zidovudine induces S-phase arrest and cell cycle gene expression changes in human cells. Mutagenesis. 2005 Mar;20(2):139-46. doi: 10.1093/mutage/gei019. Epub 2005 Mar 22.
24	Specific inhibition of cyclin-dependent kinase 4/6 by PD 0332991 and associated antitumor activity in human tumor xenografts. Mol Cancer Ther. 2004 Nov;3(11):1427-38.
25	Utilization of CDKN1A/p21 gene for class discrimination of DNA damage-induced clastogenicity. Toxicology. 2014 Jan 6;315:8-16. doi: 10.1016/j.tox.2013.10.009. Epub 2013 Nov 6.
26	Ritonavir blocks AKT signaling, activates apoptosis and inhibits migration and invasion in ovarian cancer cells. Mol Cancer. 2009 Apr 22;8:26. doi: 10.1186/1476-4598-8-26.
27	CDK4/6 Inhibition Controls Proliferation of Bladder Cancer and Transcription of RB1. J Urol. 2016 Mar;195(3):771-9. doi: 10.1016/j.juro.2015.08.082. Epub 2015 Aug 28.
28	Gene expression signature of parathion-transformed human breast epithelial cells. Int J Mol Med. 2007 May;19(5):741-50.
29	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
30	A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
31	Resveratrol-induced gene expression profiles in human prostate cancer cells. Cancer Epidemiol Biomarkers Prev. 2005 Mar;14(3):596-604. doi: 10.1158/1055-9965.EPI-04-0398.
32	Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
33	Identification of novel ER-alpha target genes in breast cancer cells: gene- and cell-selective co-regulator recruitment at target promoters determines the response to 17beta-estradiol and tamoxifen. Mol Cell Endocrinol. 2010 Jan 15;314(1):90-100.
34	Combinatorial PX-866 and Raloxifene Decrease Rb Phosphorylation, Cyclin E2 Transcription, and Proliferation of MCF-7 Breast Cancer Cells. J Cell Biochem. 2016 Jul;117(7):1688-96. doi: 10.1002/jcb.25462. Epub 2015 Dec 28.
35	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
36	Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
37	Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
38	Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
39	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
40	2-methoxyestradiol induces mitotic arrest, apoptosis, and synergistic cytotoxicity with arsenic trioxide in human urothelial carcinoma cells. PLoS One. 2013 Aug 13;8(8):e68703. doi: 10.1371/journal.pone.0068703. eCollection 2013.
41	A high-throughput chemical screen reveals that harmine-mediated inhibition of DYRK1A increases human pancreatic beta cell replication. Nat Med. 2015 Apr;21(4):383-8. doi: 10.1038/nm.3820. Epub 2015 Mar 9.
42	Lithium suppresses cell proliferation by interrupting E2F-DNA interaction and subsequently reducing S-phase gene expression in prostate cancer. Prostate. 2007 Jun 15;67(9):976-88. doi: 10.1002/pros.20586.
43	Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
44	Histone deacetylase inhibitor scriptaid induces cell cycle arrest and epigenetic change in colon cancer cells. Int J Oncol. 2008 Oct;33(4):767-76.
45	Characteristics of nobiletin-mediated alteration of gene expression in cultured cell lines. Biochem Biophys Res Commun. 2013 Feb 15;431(3):530-4.
46	Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
47	From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
48	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
49	Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
50	Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
51	Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
52	Probiotic Bacillus subtilis CW14 reduces disruption of the epithelial barrier and toxicity of ochratoxin A to Caco-2?cells. Food Chem Toxicol. 2019 Apr;126:25-33. doi: 10.1016/j.fct.2019.02.009. Epub 2019 Feb 11.
53	The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
54	Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
55	Chromatin modifiers: A new class of pollutants with potential epigenetic effects revealed by in vitro assays and transcriptomic analyses. Toxicology. 2023 Jan 15;484:153413. doi: 10.1016/j.tox.2022.153413. Epub 2022 Dec 26.
56	System analysis of cross-talk between nuclear receptors reveals an opposite regulation of the cell cycle by LXR and FXR in human HepaRG liver cells. PLoS One. 2019 Aug 22;14(8):e0220894. doi: 10.1371/journal.pone.0220894. eCollection 2019.
57	Molecular characterizations of derivatives of HCT116 colorectal cancer cells that are resistant to the chemotherapeutic agent 5-fluorouracil. Int J Oncol. 2004 May;24(5):1279-88.