Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBJMC2P)

• DOT Name: Myb-related protein A (MYBL1)
• Synonyms: A-Myb; Myb-like protein 1
• Gene Name: MYBL1
• Related Disease:
  B-cell neoplasm
  Aplasia cutis congenita
  Astrocytoma
  Corpus callosum, agenesis of
  Polycystic ovarian syndrome
  Glioma
  Lymphoma
  Malignant glioma
  Mixed glioma
• UniProt ID: MYBA_HUMAN
• Pfam ID: PF09316 ; PF07988 ; PF13921 ; PF00249
• Sequence:
  MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLVEQHGTDDWTL
  IASHLQNRSDFQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSLIAKHLKGR
  IGKQCRERWHNHLNPEVKKSSWTEEEDRIIYEAHKRLGNRWAEIAKLLPGRTDNSIKNHW
  NSTMRRKVEQEGYLQDGIKSERSSSKLQHKPCAAMDHMQTQNQFYIPVQIPGYQYVSPEG
  NCIEHVQPTSAFIQQPFIDEDPDKEKKIKELEMLLMSAENEVRRKRIPSQPGSFSSWSGS
  FLMDDNMSNTLNSLDEHTSEFYSMDENQPVSAQQNSPTKFLAVEANAVLSSLQTIPEFAE
  TLELIESDPVAWSDVTSFDISDAAASPIKSTPVKLMRIQHNEGAMECQFNVSLVLEGKKN
  TCNGGNSEAVPLTSPNIAKFSTPPAILRKKRKMRVGHSPGSELRDGSLNDGGNMALKHTP
  LKTLPFSPSQFFNTCPGNEQLNIENPSFTSTPICGQKALITTPLHKETTPKDQKENVGFR
  TPTIRRSILGTTPRTPTPFKNALAAQEKKYGPLKIVSQPLAFLEEDIREVLKEETGTDLF
  LKEEDEPAYKSCKQENTASGKKVRKSLVLDNWEKEESGTQLLTEDISDMQSENRFTTSLL
  MIPLLEIHDNRCNLIPEKQDINSTNKTYTLTKKKPNPNTSKVVKLEKNLQSNCEWETVVY
  GKTEDQLIMTEQARRYLSTYTATSSTSRALIL
• Function: Transcription factor that specifically recognizes the sequence 5'-YAAC[GT]G-3'. Acts as a master regulator of male meiosis by promoting expression of piRNAs: activates expression of both piRNA precursor RNAs and expression of protein-coding genes involved in piRNA metabolism. The piRNA metabolic process mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons, which is essential for the germline integrity. Transcriptional activator of SOX30.
• Tissue Specificity: Expressed in a variety of lymphoid and solid tumor lines cultured in vitro.
• Reactome Pathway: PIWI-interacting RNA (piRNA) biogenesis (R-HSA-5601884)

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
B-cell neoplasm	DISVY326	Definitive	Biomarker	[1]
Aplasia cutis congenita	DISMDAYM	Strong	Altered Expression	[2]
Astrocytoma	DISL3V18	Strong	Biomarker	[3]
Corpus callosum, agenesis of	DISO9P40	Strong	Altered Expression	[2]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[4]
Glioma	DIS5RPEH	Limited	Biomarker	[5]
Lymphoma	DISN6V4S	Limited	Biomarker	[6]
Malignant glioma	DISFXKOV	Limited	Biomarker	[5]
Mixed glioma	DIS64UY3	Limited	Biomarker	[5]

47 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Myb-related protein A (MYBL1).	[7]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Myb-related protein A (MYBL1).	[8]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Myb-related protein A (MYBL1).	[9]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Myb-related protein A (MYBL1).	[10]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Myb-related protein A (MYBL1).	[11]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Myb-related protein A (MYBL1).	[12]
Ivermectin	DMDBX5F	Approved	Ivermectin increases the expression of Myb-related protein A (MYBL1).	[13]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Myb-related protein A (MYBL1).	[14]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Myb-related protein A (MYBL1).	[15]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Myb-related protein A (MYBL1).	[16]
Marinol	DM70IK5	Approved	Marinol increases the expression of Myb-related protein A (MYBL1).	[17]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Myb-related protein A (MYBL1).	[13]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Myb-related protein A (MYBL1).	[18]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the expression of Myb-related protein A (MYBL1).	[19]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Myb-related protein A (MYBL1).	[20]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Myb-related protein A (MYBL1).	[19]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Myb-related protein A (MYBL1).	[21]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Myb-related protein A (MYBL1).	[22]
Estrone	DM5T6US	Approved	Estrone increases the expression of Myb-related protein A (MYBL1).	[19]
Mestranol	DMG3F94	Approved	Mestranol increases the expression of Myb-related protein A (MYBL1).	[19]
Spironolactone	DM2AQ5N	Approved	Spironolactone increases the expression of Myb-related protein A (MYBL1).	[13]
Norethindrone	DMTY169	Approved	Norethindrone increases the expression of Myb-related protein A (MYBL1).	[13]
Cyproterone	DMQXLD2	Approved	Cyproterone increases the expression of Myb-related protein A (MYBL1).	[13]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Myb-related protein A (MYBL1).	[23]
Pregnenolone	DM6VFO1	Phase 4	Pregnenolone increases the expression of Myb-related protein A (MYBL1).	[13]
Lynestrenol	DM82JP0	Phase 4	Lynestrenol increases the expression of Myb-related protein A (MYBL1).	[13]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Myb-related protein A (MYBL1).	[24]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Myb-related protein A (MYBL1).	[25]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Myb-related protein A (MYBL1).	[14]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Myb-related protein A (MYBL1).	[27]
HEXESTROL	DM9AGWQ	Withdrawn from market	HEXESTROL increases the expression of Myb-related protein A (MYBL1).	[19]
Scriptaid	DM9JZ21	Preclinical	Scriptaid increases the expression of Myb-related protein A (MYBL1).	[18]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Myb-related protein A (MYBL1).	[28]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Myb-related protein A (MYBL1).	[29]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Myb-related protein A (MYBL1).	[30]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Myb-related protein A (MYBL1).	[32]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Myb-related protein A (MYBL1).	[33]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Myb-related protein A (MYBL1).	[34]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of Myb-related protein A (MYBL1).	[35]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Myb-related protein A (MYBL1).	[36]
Chrysin	DM7V2LG	Investigative	Chrysin increases the expression of Myb-related protein A (MYBL1).	[13]
Kaempferol	DMHEMUB	Investigative	Kaempferol increases the expression of Myb-related protein A (MYBL1).	[13]
OXYBENZONE	DMMZYX6	Investigative	OXYBENZONE increases the expression of Myb-related protein A (MYBL1).	[13]
Daidzein	DMRFTJX	Investigative	Daidzein increases the expression of Myb-related protein A (MYBL1).	[13]
Apigenin	DMI3491	Investigative	Apigenin increases the expression of Myb-related protein A (MYBL1).	[13]
Apicidin	DM83WVF	Investigative	Apicidin increases the expression of Myb-related protein A (MYBL1).	[18]
ETHISTERONE	DMDXRP1	Investigative	ETHISTERONE increases the expression of Myb-related protein A (MYBL1).	[13]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Myb-related protein A (MYBL1).	[26]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Myb-related protein A (MYBL1).	[31]

References

• [1] A-myb rescues murine B-cell lymphomas from IgM-receptor-mediated apoptosis through c-myc transcriptional regulation.Blood. 2000 Aug 1;96(3):1013-20.
• [2] MYB-activated models for testing therapeutic agents in adenoid cystic carcinoma.Oral Oncol. 2019 Nov;98:147-155. doi: 10.1016/j.oraloncology.2019.09.005. Epub 2019 Oct 10.
• [3] Isomorphic diffuse glioma is a morphologically and molecularly distinct tumour entity with recurrent gene fusions of MYBL1 or MYB and a benign disease course.Acta Neuropathol. 2020 Jan;139(1):193-209. doi: 10.1007/s00401-019-02078-w. Epub 2019 Sep 28.
• [4] Progesterone resistance in PCOS endometrium: a microarray analysis in clomiphene citrate-treated and artificial menstrual cycles.J Clin Endocrinol Metab. 2011 Jun;96(6):1737-46. doi: 10.1210/jc.2010-2600. Epub 2011 Mar 16.
• [5] Whole-genome sequencing identifies genetic alterations in pediatric low-grade gliomas.Nat Genet. 2013 Jun;45(6):602-12. doi: 10.1038/ng.2611. Epub 2013 Apr 14.
• [6] Chromosome locations of the MYB related genes, AMYB and BMYB.Cancer Res. 1991 Jul 15;51(14):3821-4.
• [7] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [8] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [9] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [10] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [11] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [12] Gene regulation in an MCF-7 cell line that naturally expresses an estrogen receptor unable to directly bind DNA. Mol Cell Endocrinol. 2005 Jun 30;238(1-2):9-25. doi: 10.1016/j.mce.2005.04.005.
• [13] A Gene Expression Biomarker Identifies Chemical Modulators of Estrogen Receptor in an MCF-7 Microarray Compendium. Chem Res Toxicol. 2021 Feb 15;34(2):313-329. doi: 10.1021/acs.chemrestox.0c00243. Epub 2021 Jan 6.
• [14] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [15] Changes in gene expression profiles of multiple myeloma cells induced by arsenic trioxide (ATO): possible mechanisms to explain ATO resistance in vivo. Br J Haematol. 2005 Mar;128(5):636-44.
• [16] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [17] Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
• [18] Development and validation of the TGx-HDACi transcriptomic biomarker to detect histone deacetylase inhibitors in human TK6 cells. Arch Toxicol. 2021 May;95(5):1631-1645. doi: 10.1007/s00204-021-03014-2. Epub 2021 Mar 26.
• [19] Moving toward integrating gene expression profiling into high-throughput testing: a gene expression biomarker accurately predicts estrogen receptor alpha modulation in a microarray compendium. Toxicol Sci. 2016 May;151(1):88-103.
• [20] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [21] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [22] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [23] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [24] A high concentration of genistein down-regulates activin A, Smad3 and other TGF-beta pathway genes in human uterine leiomyoma cells. Exp Mol Med. 2012 Apr 30;44(4):281-92.
• [25] Regulation of aryl hydrocarbon receptor function by selective estrogen receptor modulators. Mol Endocrinol. 2010 Jan;24(1):33-46.
• [26] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [27] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [28] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [29] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [30] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [31] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [32] Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.
• [33] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [34] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [35] An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.
• [36] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.