Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC9U1LI)

DOT Name Mitochondrial ribosome-associated GTPase 1 (MTG1)
Synonyms GTP-binding protein 7; Mitochondrial GTPase 1
Gene Name MTG1
Related Disease
Adult hepatocellular carcinoma ( )
Adult lymphoma ( )
Advanced cancer ( )
Cardiac failure ( )
Clear cell renal carcinoma ( )
Colorectal carcinoma ( )
Congestive heart failure ( )
Dystonia 5 ( )
Epithelial ovarian cancer ( )
Fatty liver disease ( )
Liver cancer ( )
Lung cancer ( )
Lung carcinoma ( )
Lymphoma ( )
Noonan syndrome ( )
Pediatric lymphoma ( )
Renal cell carcinoma ( )
Tuberculosis ( )
Nervous system disease ( )
Triple negative breast cancer ( )
CHARGE syndrome ( )
Coeliac disease ( )
Hepatitis C virus infection ( )
Hepatocellular carcinoma ( )
Hoyeraal-Hreidarsson syndrome ( )
Hyperinsulinism-hyperammonemia syndrome ( )
Hypotrichosis 1 ( )
Inflammation ( )
Neoplasm ( )
Neuroblastoma ( )
Periodontitis ( )
Pseudohypoparathyroidism type 1A ( )
Retinopathy ( )
Stroke ( )
Type-1/2 diabetes ( )
UniProt ID
MTG1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7O9K; 7O9M; 7PD3
Pfam ID
PF01926
Sequence
MRLTPRALCSAAQAAWRENFPLCGRDVARWFPGHMAKGLKKMQSSLKLVDCIIEVHDARI
PLSGRNPLFQETLGLKPHLLVLNKMDLADLTEQQKIMQHLEGEGLKNVIFTNCVKDENVK
QIIPMVTELIGRSHRYHRKENLEYCIMVIGVPNVGKSSLINSLRRQHLRKGKATRVGGEP
GITRAVMSKIQVSERPLMFLLDTPGVLAPRIESVETGLKLALCGTVLDHLVGEETMADYL
LYTLNKHQRFGYVQHYGLGSACDNVERVLKSVAVKLGKTQKVKVLTGTGNVNIIQPNYPA
AARDFLQTFRRGLLGSVMLDLDVLRGHPPAETLP
Function Plays a role in the regulation of the mitochondrial ribosome assembly and of translational activity. Displays mitochondrial GTPase activity.

Molecular Interaction Atlas (MIA) of This DOT

35 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adult hepatocellular carcinoma DIS6ZPAI Strong Altered Expression [1]
Adult lymphoma DISK8IZR Strong Genetic Variation [2]
Advanced cancer DISAT1Z9 Strong Altered Expression [3]
Cardiac failure DISDC067 Strong Biomarker [4]
Clear cell renal carcinoma DISBXRFJ Strong Biomarker [5]
Colorectal carcinoma DIS5PYL0 Strong Altered Expression [6]
Congestive heart failure DIS32MEA Strong Biomarker [4]
Dystonia 5 DISMPJ7S Strong Biomarker [7]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [8]
Fatty liver disease DIS485QZ Strong Biomarker [9]
Liver cancer DISDE4BI Strong Altered Expression [1]
Lung cancer DISCM4YA Strong Altered Expression [1]
Lung carcinoma DISTR26C Strong Altered Expression [1]
Lymphoma DISN6V4S Strong Genetic Variation [2]
Noonan syndrome DIS7Q7DN Strong Genetic Variation [10]
Pediatric lymphoma DIS51BK2 Strong Genetic Variation [2]
Renal cell carcinoma DISQZ2X8 Strong Biomarker [5]
Tuberculosis DIS2YIMD Strong Biomarker [11]
Nervous system disease DISJ7GGT moderate Biomarker [12]
Triple negative breast cancer DISAMG6N moderate Altered Expression [13]
CHARGE syndrome DISKD3CW Limited Genetic Variation [14]
Coeliac disease DISIY60C Limited Biomarker [15]
Hepatitis C virus infection DISQ0M8R Limited Biomarker [16]
Hepatocellular carcinoma DIS0J828 Limited Biomarker [17]
Hoyeraal-Hreidarsson syndrome DISAUR8F Limited Genetic Variation [14]
Hyperinsulinism-hyperammonemia syndrome DISP0IHP Limited Biomarker [14]
Hypotrichosis 1 DIS0XPER Limited Genetic Variation [14]
Inflammation DISJUQ5T Limited Biomarker [15]
Neoplasm DISZKGEW Limited Altered Expression [3]
Neuroblastoma DISVZBI4 Limited Biomarker [18]
Periodontitis DISI9JOI Limited Genetic Variation [19]
Pseudohypoparathyroidism type 1A DISSOR3M Limited Genetic Variation [20]
Retinopathy DISB4B0F Limited Genetic Variation [21]
Stroke DISX6UHX Limited Genetic Variation [22]
Type-1/2 diabetes DISIUHAP Limited Biomarker [15]
------------------------------------------------------------------------------------
⏷ Show the Full List of 35 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Mitochondrial ribosome-associated GTPase 1 (MTG1). [23]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Mitochondrial ribosome-associated GTPase 1 (MTG1). [24]
Tretinoin DM49DUI Approved Tretinoin affects the expression of Mitochondrial ribosome-associated GTPase 1 (MTG1). [25]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Mitochondrial ribosome-associated GTPase 1 (MTG1). [26]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of Mitochondrial ribosome-associated GTPase 1 (MTG1). [27]
Ethinyl estradiol DMODJ40 Approved Ethinyl estradiol decreases the expression of Mitochondrial ribosome-associated GTPase 1 (MTG1). [28]
Tamibarotene DM3G74J Phase 3 Tamibarotene affects the expression of Mitochondrial ribosome-associated GTPase 1 (MTG1). [25]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Mitochondrial ribosome-associated GTPase 1 (MTG1). [30]
Coumestrol DM40TBU Investigative Coumestrol increases the expression of Mitochondrial ribosome-associated GTPase 1 (MTG1). [31]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Mitochondrial ribosome-associated GTPase 1 (MTG1). [29]
------------------------------------------------------------------------------------

References

1 DDEFL1 correlated with Rho GTPases activity in breast cancer.Oncotarget. 2017 Oct 26;8(68):112487-112497. doi: 10.18632/oncotarget.22095. eCollection 2017 Dec 22.
2 Wiskott-Aldrich syndrome protein (WASP) is a tumor suppressor in T cell lymphoma.Nat Med. 2019 Jan;25(1):130-140. doi: 10.1038/s41591-018-0262-9. Epub 2018 Dec 3.
3 Hybrid QM/MM vs Pure MM Molecular Dynamics for Evaluating Water Distribution within p21(N-ras) and the Resulting GTP Electronic Density.J Phys Chem B. 2019 May 9;123(18):3935-3944. doi: 10.1021/acs.jpcb.9b02660. Epub 2019 Apr 25.
4 Novel role of mitochondrial GTPases 1 in pathological cardiac hypertrophy.J Mol Cell Cardiol. 2019 Mar;128:105-116. doi: 10.1016/j.yjmcc.2019.01.025. Epub 2019 Jan 29.
5 Induction of cell cycle arrest by increasing GTPRhoA levels via Taxolinduced microtubule polymerization in renal cell carcinoma.Mol Med Rep. 2017 Jun;15(6):4273-4279. doi: 10.3892/mmr.2017.6543. Epub 2017 May 3.
6 RAC1-GTP promotes epithelial-mesenchymal transition and invasion of colorectal cancer by activation of STAT3.Lab Invest. 2018 Aug;98(8):989-998. doi: 10.1038/s41374-018-0071-2. Epub 2018 Jun 8.
7 Non-motor symptoms and quality of life in dopa-responsive dystonia patients.Parkinsonism Relat Disord. 2017 Dec;45:57-62. doi: 10.1016/j.parkreldis.2017.10.005. Epub 2017 Oct 10.
8 Septin-2 is overexpressed in epithelial ovarian cancer and mediates proliferation via regulation of cellular metabolic proteins.Oncotarget. 2019 Apr 26;10(31):2959-2972. doi: 10.18632/oncotarget.26836. eCollection 2019 Apr 26.
9 Effect of ipragliflozin on liver function in Japanese type 2 diabetes mellitus patients: a subgroup analysis of the STELLA-LONG TERM study (3-month interim results).Endocr J. 2019 Jan 28;66(1):31-41. doi: 10.1507/endocrj.EJ18-0217. Epub 2018 Nov 3.
10 Activating Mutations of RRAS2 Are a Rare Cause of Noonan Syndrome. Am J Hum Genet. 2019 Jun 6;104(6):1223-1232. doi: 10.1016/j.ajhg.2019.04.013. Epub 2019 May 23.
11 Mutation at G103 of MtbFtsZ Altered their Sensitivity to Coumarins.Front Microbiol. 2017 Apr 6;8:578. doi: 10.3389/fmicb.2017.00578. eCollection 2017.
12 Selected C8 two-chain linkers enhance the adenosine A 1/A 2A receptor affinity and selectivity of caffeine. Eur J Med Chem. 2017 Jan 5; 125:652-656.
13 TUFT1 promotes metastasis and chemoresistance in triple negative breast cancer through the TUFT1/Rab5/Rac1 pathway.Cancer Cell Int. 2019 Sep 23;19:242. doi: 10.1186/s12935-019-0961-4. eCollection 2019.
14 Glutamate dehydrogenase: Structure of a hyperinsulinism mutant, corrections to the atomic model, and insights into a regulatory site.Proteins. 2019 Jan;87(1):41-50. doi: 10.1002/prot.25620. Epub 2018 Nov 18.
15 Structure of natural variant transglutaminase 2 reveals molecular basis of gaining stability and higher activity.PLoS One. 2018 Oct 15;13(10):e0204707. doi: 10.1371/journal.pone.0204707. eCollection 2018.
16 Molecular dynamics and docking reveal the potency of novel GTP derivatives against RNA dependent RNA polymerase of genotype 4a HCV.Life Sci. 2019 Dec 1;238:116958. doi: 10.1016/j.lfs.2019.116958. Epub 2019 Oct 16.
17 Elevated expression of cellular SYNE1, MMP10, and GTPase1 and their regulatory role in hepatocellular carcinoma progression.Protoplasma. 2020 Jan;257(1):157-167. doi: 10.1007/s00709-019-01423-w. Epub 2019 Aug 19.
18 Mouse Neuroblastoma CB(1) Cannabinoid Receptor-Stimulated [(35)S]GTPS Binding: Total and Antibody-Targeted G Protein-Specific Scintillation Proximity Assays.Methods Enzymol. 2017;593:1-21. doi: 10.1016/bs.mie.2017.06.028. Epub 2017 Jul 19.
19 Periodontal disease, peri-implant disease and levels of salivary biomarkers IL-1, IL-10, RANK, OPG, MMP-2, TGF- and TNF-: follow-up over 5 years.J Appl Oral Sci. 2019 Feb 21;27:e20180316. doi: 10.1590/1678-7757-2018-0316.
20 Disease-Causing Mutations in the G Protein Gs Subvert the Roles of GDP and GTP.Cell. 2018 May 17;173(5):1254-1264.e11. doi: 10.1016/j.cell.2018.03.018. Epub 2018 Apr 5.
21 A Nucleotide-Dependent Conformational Switch Controls the Polymerization of Human IMP Dehydrogenases to Modulate their Catalytic Activity.J Mol Biol. 2019 Mar 1;431(5):956-969. doi: 10.1016/j.jmb.2019.01.020. Epub 2019 Jan 18.
22 Driving Forces of Translocation Through Bacterial Translocon SecYEG.J Membr Biol. 2018 Jun;251(3):329-343. doi: 10.1007/s00232-017-0012-9. Epub 2018 Jan 12.
23 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
24 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
25 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
26 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
27 Gingival Stromal Cells as an In Vitro Model: Cannabidiol Modulates Genes Linked With Amyotrophic Lateral Sclerosis. J Cell Biochem. 2017 Apr;118(4):819-828. doi: 10.1002/jcb.25757. Epub 2016 Nov 28.
28 The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
29 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
30 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
31 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.