Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEID3ZM)

• DOT Name: Hypoxia-inducible lipid droplet-associated protein (HILPDA)
• Synonyms: Hypoxia-inducible gene 2 protein
• Gene Name: HILPDA
• Related Disease:
  Advanced cancer
  Arteriosclerosis
  Atherosclerosis
  Carcinoma
  Chronic renal failure
  Colorectal carcinoma
  End-stage renal disease
  Glioblastoma multiforme
  Hemangioblastoma
  Hepatitis C virus infection
  Hereditary hemochromatosis
  Kidney neoplasm
  Lung cancer
  Lung neoplasm
  Mantle cell lymphoma
  Neoplasm
  Systemic lupus erythematosus
  Tuberculosis
  Von hippel-lindau disease
  Hepatocellular carcinoma
  Iron metabolism disease
  Clear cell renal carcinoma
  Renal cell carcinoma
• UniProt ID: HLPDA_HUMAN
• Pfam ID: PF15220
• Sequence:
  MKHVLNLYLLGVVLTLLSIFVRVMESLEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPS
  RSM
• Function: Increases intracellular lipid accumulation. Stimulates expression of cytokines including IL6, MIF and VEGFA. Enhances cell growth and proliferation.
• Tissue Specificity: Highly expressed in renal cell carcinoma cells but barely detectable in adjacent normal kidney tissue. Detected in some cervical and endometrial cancers. Expression also detected in fetal kidney with little or no expression observed in normal adult heart, liver, lung, pancreas, prostate or spinal cord (at protein level).
• Reactome Pathway: Lipid particle organization (R-HSA-8964572)

Molecular Interaction Atlas (MIA) of This DOT

23 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[2]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[2]
Carcinoma	DISH9F1N	Strong	Altered Expression	[3]
Chronic renal failure	DISGG7K6	Strong	Altered Expression	[4]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[5]
End-stage renal disease	DISXA7GG	Strong	Altered Expression	[4]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[6]
Hemangioblastoma	DIS1EAZC	Strong	Altered Expression	[7]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[8]
Hereditary hemochromatosis	DISVG5MT	Strong	Biomarker	[8]
Kidney neoplasm	DISBNZTN	Strong	Altered Expression	[1]
Lung cancer	DISCM4YA	Strong	Biomarker	[9]
Lung neoplasm	DISVARNB	Strong	Biomarker	[9]
Mantle cell lymphoma	DISFREOV	Strong	Biomarker	[10]
Neoplasm	DISZKGEW	Strong	Biomarker	[11]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[12]
Tuberculosis	DIS2YIMD	Strong	Biomarker	[13]
Von hippel-lindau disease	DIS6ZFQQ	Strong	Altered Expression	[7]
Hepatocellular carcinoma	DIS0J828	moderate	Biomarker	[14]
Iron metabolism disease	DISWDM9J	moderate	Altered Expression	[15]
Clear cell renal carcinoma	DISBXRFJ	Limited	Biomarker	[16]
Renal cell carcinoma	DISQZ2X8	Limited	Biomarker	[16]

33 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[17]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[18]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[19]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[20]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[21]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[22]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[23]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[24]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[25]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[26]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[27]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[28]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[29]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[28]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[28]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[30]
Amphotericin B	DMTAJQE	Approved	Amphotericin B decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[31]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[32]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[32]
Methylprednisolone	DM4BDON	Approved	Methylprednisolone decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[28]
Vandetanib	DMRICNP	Approved	Vandetanib increases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[33]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[34]
Lithium	DMZ3OU6	Phase 2	Lithium decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[35]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[36]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[37]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[38]
Celastrol	DMWQIJX	Preclinical	Celastrol decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[39]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[40]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[41]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[42]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[43]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[24]
Resorcinol	DMM37C0	Investigative	Resorcinol increases the expression of Hypoxia-inducible lipid droplet-associated protein (HILPDA).	[44]

References

• [1] Receptor and secreted targets of Wnt-1/beta-catenin signalling in mouse mammary epithelial cells.BMC Cancer. 2005 Jan 10;5:3. doi: 10.1186/1471-2407-5-3.
• [2] Hypoxia-inducible protein 2 Hig2/Hilpda mediates neutral lipid accumulation in macrophages and contributes to atherosclerosis in apolipoprotein E-deficient mice.FASEB J. 2017 Nov;31(11):4971-4984. doi: 10.1096/fj.201700235R. Epub 2017 Jul 31.
• [3] Hypoxia-inducible protein 2 is a novel lipid droplet protein and a specific target gene of hypoxia-inducible factor-1.FASEB J. 2010 Nov;24(11):4443-58. doi: 10.1096/fj.10-159806. Epub 2010 Jul 12.
• [4] Over expression of hypoxia-inducible protein 2, hypoxia-inducible factor-1alpha and nuclear factor kappaB is putatively involved in acquired renal cyst formation and subsequent tumor transformation in patients with end stage renal failure.J Urol. 2008 Aug;180(2):481-5. doi: 10.1016/j.juro.2008.04.006. Epub 2008 Jun 11.
• [5] HIG2 promotes colorectal cancer progression via hypoxia-dependent and independent pathways.Cancer Lett. 2013 Dec 1;341(2):159-65. doi: 10.1016/j.canlet.2013.07.028. Epub 2013 Aug 2.
• [6] Hypoxia increases the expression of stem-cell markers and promotes clonogenicity in glioblastoma neurospheres.Am J Pathol. 2010 Sep;177(3):1491-502. doi: 10.2353/ajpath.2010.091021. Epub 2010 Jul 29.
• [7] Expression of HIF-1 regulated proteins vascular endothelial growth factor, carbonic anhydrase IX and hypoxia inducible gene 2 in hemangioblastomas.Folia Neuropathol. 2014;52(3):234-42. doi: 10.5114/fn.2014.45564.
• [8] In vitro-targeted gene identification in patients with hepatitis C using a genome-wide microarray technology.Hepatology. 2009 Feb;49(2):378-86. doi: 10.1002/hep.22677.
• [9] Bronchial airway gene expression signatures in mouse lung squamous cell carcinoma and their modulation by cancer chemopreventive agents.Oncotarget. 2017 Mar 21;8(12):18885-18900. doi: 10.18632/oncotarget.13806.
• [10] SOX11 and HIG-2 are cross-regulated and affect growth in mantle cell lymphoma.Leuk Lymphoma. 2016 Aug;57(8):1883-92. doi: 10.3109/10428194.2015.1121257. Epub 2016 Jan 12.
• [11] HILPDA Regulates Lipid Metabolism, Lipid Droplet Abundance, and Response to Microenvironmental Stress in Solid Tumors.Mol Cancer Res. 2019 Oct;17(10):2089-2101. doi: 10.1158/1541-7786.MCR-18-1343. Epub 2019 Jul 15.
• [12] Gene profiling involved in immature CD4+ T lymphocyte responsible for systemic lupus erythematosus.Mol Immunol. 2006 Mar;43(9):1497-507. doi: 10.1016/j.molimm.2005.07.039. Epub 2005 Sep 6.
• [13] Lipid droplet formation in Mycobacterium tuberculosis infected macrophages requires IFN-/HIF-1 signaling and supports host defense.PLoS Pathog. 2018 Jan 25;14(1):e1006874. doi: 10.1371/journal.ppat.1006874. eCollection 2018 Jan.
• [14] Hypoxia-inducible gene 2 promotes the immune escape of hepatocellular carcinoma from nature killer cells through the interleukin-10-STAT3 signaling pathway.J Exp Clin Cancer Res. 2019 May 29;38(1):229. doi: 10.1186/s13046-019-1233-9.
• [15] Long Non-Coding RNA PVT1/miR-150/ HIG2 Axis Regulates the Proliferation, Invasion and the Balance of Iron Metabolism of Hepatocellular Carcinoma.Cell Physiol Biochem. 2018;49(4):1403-1419. doi: 10.1159/000493445. Epub 2018 Sep 11.
• [16] Effective induction of cytotoxic T cells recognizing an epitope peptide derived from hypoxia-inducible protein 2 (HIG2) in patients with metastatic renal cell carcinoma.Cancer Immunol Immunother. 2017 Jan;66(1):17-24. doi: 10.1007/s00262-016-1915-5. Epub 2016 Oct 18.
• [17] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [18] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [19] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [20] Anthracycline inhibits recruitment of hypoxia-inducible transcription factors and suppresses tumor cell migration and cardiac angiogenic response in the host. J Biol Chem. 2012 Oct 12;287(42):34866-34882. doi: 10.1074/jbc.M112.374587. Epub 2012 Aug 20.
• [21] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [22] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [23] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [24] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [25] Changes in gene expression profiles of multiple myeloma cells induced by arsenic trioxide (ATO): possible mechanisms to explain ATO resistance in vivo. Br J Haematol. 2005 Mar;128(5):636-44.
• [26] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [27] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [28] Antirheumatic drug response signatures in human chondrocytes: potential molecular targets to stimulate cartilage regeneration. Arthritis Res Ther. 2009;11(1):R15.
• [29] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [30] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [31] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [32] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [33] ZD6474 inhibits tumor growth and intraperitoneal dissemination in a highly metastatic orthotopic gastric cancer model. Int J Cancer. 2006 Jan 15;118(2):483-9. doi: 10.1002/ijc.21340.
• [34] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [35] A genetic network model of cellular responses to lithium treatment and cocaine abuse in bipolar disorder. BMC Syst Biol. 2010 Nov 19;4:158. doi: 10.1186/1752-0509-4-158.
• [36] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [37] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [38] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [39] Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.
• [40] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [41] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [42] In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
• [43] Effects of nickel treatment on H3K4 trimethylation and gene expression. PLoS One. 2011 Mar 24;6(3):e17728. doi: 10.1371/journal.pone.0017728.
• [44] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.