Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFHHDRU)

DOT Name Caveolae-associated protein 2 (CAVIN2)
Synonyms Cavin-2; PS-p68; Phosphatidylserine-binding protein; Serum deprivation-response protein
Gene Name CAVIN2
Related Disease
Thyroid cancer ( )
Thyroid gland carcinoma ( )
Thyroid gland papillary carcinoma ( )
Thyroid tumor ( )
Advanced cancer ( )
Breast neoplasm ( )
Cerebral palsy ( )
Clear cell renal carcinoma ( )
Glioma ( )
Hepatitis B virus infection ( )
Hepatitis C virus infection ( )
Hepatocellular carcinoma ( )
Liver cirrhosis ( )
Lung adenocarcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Malignant soft tissue neoplasm ( )
Non-small-cell lung cancer ( )
Oral cancer ( )
Renal cell carcinoma ( )
Sarcoma ( )
Spastic quadriplegic cerebral palsy ( )
Tuberculosis ( )
Breast cancer ( )
Breast carcinoma ( )
Hirschsprung disease ( )
Laryngeal squamous cell carcinoma ( )
Liposarcoma ( )
Retinopathy ( )
Soft tissue sarcoma ( )
Thyroid gland follicular carcinoma ( )
Neoplasm ( )
Post-traumatic stress disorder ( )
Rheumatoid arthritis ( )
UniProt ID
CAVN2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15237
Sequence
MGEDAAQAEKFQHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLT
LLDKLVNMLDAVQENQHKMEQRQISLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRK
VSAHTRAVKERMDRQCAQVKRLENNHAQLLRRNHFKVLIFQEENEIPASVFVKQPVSGAV
EGKEELPDENKSLEETLHTVDLSSDDDLPHDEEALEDSAEEKVEESRAEKIKRSSLKKVD
SLKKAFSRQNIEKKMNKLGTKIVSVERREKIKKSLTSNHQKISSGKSSPFKVSPLTFGRK
KVREGESHAENETKSEDLPSSEQMPNDQEEESFAEGHSEASLASALVEGEIAEEAAEKAT
SRGSNSGMDSNIDLTIVEDEEEESVALEQAQKVRYEGSYALTSEEAERSDGDPVQPAVLQ
VHQTS
Function
Plays an important role in caveolar biogenesis and morphology. Regulates caveolae morphology by inducing membrane curvature within caveolae. Plays a role in caveola formation in a tissue-specific manner. Required for the formation of caveolae in the lung and fat endothelia but not in the heart endothelia. Negatively regulates the size or stability of CAVIN complexes in the lung endothelial cells. May play a role in targeting PRKCA to caveolae.
Tissue Specificity Highly expressed in heart and lung, and expressed at lower levels in brain, kidney, liver, pancreas, placenta, and skeletal muscle.

Molecular Interaction Atlas (MIA) of This DOT

34 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Thyroid cancer DIS3VLDH Definitive Biomarker [1]
Thyroid gland carcinoma DISMNGZ0 Definitive Biomarker [1]
Thyroid gland papillary carcinoma DIS48YMM Definitive Altered Expression [1]
Thyroid tumor DISLVKMD Definitive Biomarker [1]
Advanced cancer DISAT1Z9 Strong Altered Expression [2]
Breast neoplasm DISNGJLM Strong Altered Expression [3]
Cerebral palsy DIS82ODL Strong Altered Expression [4]
Clear cell renal carcinoma DISBXRFJ Strong Altered Expression [5]
Glioma DIS5RPEH Strong Biomarker [6]
Hepatitis B virus infection DISLQ2XY Strong Altered Expression [7]
Hepatitis C virus infection DISQ0M8R Strong Altered Expression [8]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [7]
Liver cirrhosis DIS4G1GX Strong Altered Expression [7]
Lung adenocarcinoma DISD51WR Strong Biomarker [2]
Lung cancer DISCM4YA Strong Altered Expression [2]
Lung carcinoma DISTR26C Strong Altered Expression [2]
Malignant soft tissue neoplasm DISTC6NO Strong Biomarker [2]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [9]
Oral cancer DISLD42D Strong Biomarker [10]
Renal cell carcinoma DISQZ2X8 Strong Altered Expression [5]
Sarcoma DISZDG3U Strong Biomarker [2]
Spastic quadriplegic cerebral palsy DISBJRHC Strong Altered Expression [4]
Tuberculosis DIS2YIMD Strong Biomarker [11]
Breast cancer DIS7DPX1 moderate Altered Expression [12]
Breast carcinoma DIS2UE88 moderate Altered Expression [12]
Hirschsprung disease DISUUSM1 moderate Biomarker [13]
Laryngeal squamous cell carcinoma DIS9UUVF moderate Genetic Variation [14]
Liposarcoma DIS8IZVM moderate Altered Expression [15]
Retinopathy DISB4B0F moderate Altered Expression [16]
Soft tissue sarcoma DISSN8XB moderate Biomarker [15]
Thyroid gland follicular carcinoma DISFK2QT moderate Altered Expression [17]
Neoplasm DISZKGEW Limited Biomarker [2]
Post-traumatic stress disorder DISHL1EY Limited Genetic Variation [18]
Rheumatoid arthritis DISTSB4J Limited Biomarker [19]
------------------------------------------------------------------------------------
⏷ Show the Full List of 34 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Caveolae-associated protein 2 (CAVIN2). [20]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of Caveolae-associated protein 2 (CAVIN2). [39]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Caveolae-associated protein 2 (CAVIN2). [40]
------------------------------------------------------------------------------------
21 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Caveolae-associated protein 2 (CAVIN2). [21]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Caveolae-associated protein 2 (CAVIN2). [22]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Caveolae-associated protein 2 (CAVIN2). [23]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Caveolae-associated protein 2 (CAVIN2). [24]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Caveolae-associated protein 2 (CAVIN2). [25]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Caveolae-associated protein 2 (CAVIN2). [26]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Caveolae-associated protein 2 (CAVIN2). [27]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Caveolae-associated protein 2 (CAVIN2). [28]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Caveolae-associated protein 2 (CAVIN2). [29]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the expression of Caveolae-associated protein 2 (CAVIN2). [30]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Caveolae-associated protein 2 (CAVIN2). [31]
Menadione DMSJDTY Approved Menadione affects the expression of Caveolae-associated protein 2 (CAVIN2). [32]
Hydroquinone DM6AVR4 Approved Hydroquinone decreases the expression of Caveolae-associated protein 2 (CAVIN2). [33]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of Caveolae-associated protein 2 (CAVIN2). [34]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Caveolae-associated protein 2 (CAVIN2). [35]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Caveolae-associated protein 2 (CAVIN2). [21]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Caveolae-associated protein 2 (CAVIN2). [36]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Caveolae-associated protein 2 (CAVIN2). [37]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Caveolae-associated protein 2 (CAVIN2). [38]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Caveolae-associated protein 2 (CAVIN2). [41]
AM251 DMTAWHL Investigative AM251 decreases the expression of Caveolae-associated protein 2 (CAVIN2). [42]
------------------------------------------------------------------------------------
⏷ Show the Full List of 21 Drug(s)

References

1 Serum deprivation response functions as a tumor suppressor gene in papillary thyroid cancer.Clin Genet. 2019 Nov;96(5):418-428. doi: 10.1111/cge.13609. Epub 2019 Jul 31.
2 A systematic analysis reveals gene expression alteration of serum deprivation response (SDPR) gene is significantly associated with the survival of patients with cancer.Oncol Rep. 2019 Sep;42(3):1161-1172. doi: 10.3892/or.2019.7212. Epub 2019 Jun 26.
3 Down-regulation of the cavin family proteins in breast cancer.J Cell Biochem. 2012 Jan;113(1):322-8. doi: 10.1002/jcb.23358.
4 Whether the newly modified rhizotomy protocol is applicable to guide single-level approach SDR to treat spastic quadriplegia and diplegia in pediatric patients with cerebral palsy?.Childs Nerv Syst. 2020 Sep;36(9):1935-1943. doi: 10.1007/s00381-019-04368-w. Epub 2019 Sep 9.
5 Downregulation of lncRNA SDPR-AS is associated with poor prognosis in renal cell carcinoma.Onco Targets Ther. 2017 Jun 19;10:3039-3047. doi: 10.2147/OTT.S137641. eCollection 2017.
6 Lentivirus-mediated overexpression of HSDL2 suppresses cell proliferation and induces apoptosis in cholangiocarcinoma.Onco Targets Ther. 2018 Oct 17;11:7133-7142. doi: 10.2147/OTT.S176410. eCollection 2018.
7 Prognostic and Diagnostic Significance of SDPR-Cavin-2 in Hepatocellular Carcinoma.Cell Physiol Biochem. 2016;39(3):950-60. doi: 10.1159/000447803. Epub 2016 Aug 12.
8 Increases in endothelial caveolin-1 and cavins correlate with cirrhosis progression.Micron. 2015 Sep;76:52-61. doi: 10.1016/j.micron.2015.03.009. Epub 2015 Mar 31.
9 Long non-coding RNA SDPR-AS affects the development of non-small cell lung cancer by regulating SDPR through p38 MAPK/ERK signals.Artif Cells Nanomed Biotechnol. 2019 Dec;47(1):3172-3179. doi: 10.1080/21691401.2019.1642904.
10 Cavin-2 in oral cancer: A potential predictor for tumor progression.Mol Carcinog. 2016 Jun;55(6):1037-47. doi: 10.1002/mc.22347. Epub 2015 Jun 18.
11 The short-chain dehydrogenases/reductases (SDR) gene: A new specific target for rapid detection of Mycobacterium tuberculosis complex by modified comparative genomic analysis.Infect Genet Evol. 2019 Jun;70:158-164. doi: 10.1016/j.meegid.2019.01.012. Epub 2019 Jan 12.
12 SDPR functions as a metastasis suppressor in breast cancer by promoting apoptosis.Proc Natl Acad Sci U S A. 2016 Jan 19;113(3):638-43. doi: 10.1073/pnas.1514663113. Epub 2016 Jan 6.
13 Aberrant expressions of miRNA-206 target, FN1, in multifactorial Hirschsprung disease.Orphanet J Rare Dis. 2019 Jan 7;14(1):5. doi: 10.1186/s13023-018-0973-5.
14 DIRC3 and near NABP1 genetic polymorphisms are associated laryngeal squamous cell carcinoma patient survival.Oncotarget. 2016 Nov 29;7(48):79596-79604. doi: 10.18632/oncotarget.12865.
15 Cavin-2 is a specific marker for detection of well-differentiated liposarcoma.Biochem Biophys Res Commun. 2017 Nov 4;493(1):660-665. doi: 10.1016/j.bbrc.2017.08.135. Epub 2017 Sep 1.
16 Cavin-2 regulates the activity and stability of endothelial nitric-oxide synthase (eNOS) in angiogenesis.J Biol Chem. 2017 Oct 27;292(43):17760-17776. doi: 10.1074/jbc.M117.794743. Epub 2017 Sep 14.
17 Molecular differences between human thyroid follicular adenoma and carcinoma revealed by analysis of a murine model of thyroid cancer.Endocrinology. 2013 Sep;154(9):3043-53. doi: 10.1210/en.2013-1028. Epub 2013 Jun 10.
18 The relationship between sense of coherence and post-traumatic stress: a meta-analysis.Eur J Psychotraumatol. 2019 Jan 17;10(1):1562839. doi: 10.1080/20008198.2018.1562839. eCollection 2019.
19 Familial rheumatoid arthritis in patients referred to rheumatology clinics of Tabriz, Iran.Int J Rheum Dis. 2012 Feb;15(1):110-5. doi: 10.1111/j.1756-185X.2011.01664.x. Epub 2011 Sep 14.
20 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
21 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
22 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
23 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
24 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
25 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
26 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
27 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
28 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
29 Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
30 Unique signatures of stress-induced senescent human astrocytes. Exp Neurol. 2020 Dec;334:113466. doi: 10.1016/j.expneurol.2020.113466. Epub 2020 Sep 17.
31 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
32 Time series analysis of oxidative stress response patterns in HepG2: a toxicogenomics approach. Toxicology. 2013 Apr 5;306:24-34.
33 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
34 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
35 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
36 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
37 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
38 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
39 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
40 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
41 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
42 Cannabinoid derivatives induce cell death in pancreatic MIA PaCa-2 cells via a receptor-independent mechanism. FEBS Lett. 2006 Mar 20;580(7):1733-9.