Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTH0UOCZ)

• DOT Name: Apolipoprotein B-100 (APOB)
• Synonyms: Apo B-100
• Gene Name: APOB
• Related Disease:
  Familial hypobetalipoproteinemia 1
  Hypercholesterolemia, autosomal dominant, type B
  Homozygous familial hypercholesterolemia
• UniProt ID: APOB_HUMAN
• Pfam ID: PF12491 ; PF06448 ; PF09172 ; PF01347
• Sequence:
  MDPPRPALLALLALPALLLLLLAGARAEEEMLENVSLVCPKDATRFKHLRKYTYNYEAES
  SSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSE
  EFAAAMSRYELKLAIPEGKQVFLYPEKDEPTYILNIKRGIISALLVPPETEEAKQVLFLD
  TVYGNCSTHFTVKTRKGNVATEISTERDLGQCDRFKPIRTGISPLALIKGMTRPLSTLIS
  SSQSCQYTLDAKRKHVAEAICKEQHLFLPFSYKNKYGMVAQVTQTLKLEDTPKINSRFFG
  EGTKKMGLAFESTKSTSPPKQAEAVLKTLQELKKLTISEQNIQRANLFNKLVTELRGLSD
  EAVTSLLPQLIEVSSPITLQALVQCGQPQCSTHILQWLKRVHANPLLIDVVTYLVALIPE
  PSAQQLREIFNMARDQRSRATLYALSHAVNNYHKTNPTGTQELLDIANYLMEQIQDDCTG
  DEDYTYLILRVIGNMGQTMEQLTPELKSSILKCVQSTKPSLMIQKAAIQALRKMEPKDKD
  QEVLLQTFLDDASPGDKRLAAYLMLMRSPSQADINKIVQILPWEQNEQVKNFVASHIANI
  LNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLI
  FDPNNYLPKESMLKTTLTAFGFASADLIEIGLEGKGFEPTLEALFGKQGFFPDSVNKALY
  WVNGQVPDGVSKVLVDHFGYTKDDKHEQDMVNGIMLSVEKLIKDLKSKEVPEARAYLRIL
  GEELGFASLHDLQLLGKLLLMGARTLQGIPQMIGEVIRKGSKNDFFLHYIFMENAFELPT
  GAGLQLQISSSGVIAPGAKAGVKLEVANMQAELVAKPSVSVEFVTNMGIIIPDFARSGVQ
  MNTNFFHESGLEAHVALKAGKLKFIIPSPKRPVKLLSGGNTLHLVSTTKTEVIPPLIENR
  QSWSVCKQVFPGLNYCTSGAYSNASSTDSASYYPLTGDTRLELELRPTGEIEQYSVSATY
  ELQREDRALVDTLKFVTQAEGAKQTEATMTFKYNRQSMTLSSEVQIPDFDVDLGTILRVN
  DESTEGKTSYRLTLDIQNKKITEVALMGHLSCDTKEERKIKGVISIPRLQAEARSEILAH
  WSPAKLLLQMDSSATAYGSTVSKRVAWHYDEEKIEFEWNTGTNVDTKKMTSNFPVDLSDY
  PKSLHMYANRLLDHRVPQTDMTFRHVGSKLIVAMSSWLQKASGSLPYTQTLQDHLNSLKE
  FNLQNMGLPDFHIPENLFLKSDGRVKYTLNKNSLKIEIPLPFGGKSSRDLKMLETVRTPA
  LHFKSVGFHLPSREFQVPTFTIPKLYQLQVPLLGVLDLSTNVYSNLYNWSASYSGGNTST
  DHFSLRARYHMKADSVVDLLSYNVQGSGETTYDHKNTFTLSCDGSLRHKFLDSNIKFSHV
  EKLGNNPVSKGLLIFDASSSWGPQMSASVHLDSKKKQHLFVKEVKIDGQFRVSSFYAKGT
  YGLSCQRDPNTGRLNGESNLRFNSSYLQGTNQITGRYEDGTLSLTSTSDLQSGIIKNTAS
  LKYENYELTLKSDTNGKYKNFATSNKMDMTFSKQNALLRSEYQADYESLRFFSLLSGSLN
  SHGLELNADILGTDKINSGAHKATLRIGQDGISTSATTNLKCSLLVLENELNAELGLSGA
  SMKLTTNGRFREHNAKFSLDGKAALTELSLGSAYQAMILGVDSKNIFNFKVSQEGLKLSN
  DMMGSYAEMKFDHTNSLNIAGLSLDFSSKLDNIYSSDKFYKQTVNLQLQPYSLVTTLNSD
  LKYNALDLTNNGKLRLEPLKLHVAGNLKGAYQNNEIKHIYAISSAALSASYKADTVAKVQ
  GVEFSHRLNTDIAGLASAIDMSTNYNSDSLHFSNVFRSVMAPFTMTIDAHTNGNGKLALW
  GEHTGQLYSKFLLKAEPLAFTFSHDYKGSTSHHLVSRKSISAALEHKVSALLTPAEQTGT
  WKLKTQFNNNEYSQDLDAYNTKDKIGVELTGRTLADLTLLDSPIKVPLLLSEPINIIDAL
  EMRDAVEKPQEFTIVAFVKYDKNQDVHSINLPFFETLQEYFERNRQTIIVVLENVQRNLK
  HINIDQFVRKYRAALGKLPQQANDYLNSFNWERQVSHAKEKLTALTKKYRITENDIQIAL
  DDAKINFNEKLSQLQTYMIQFDQYIKDSYDLHDLKIAIANIIDEIIEKLKSLDEHYHIRV
  NLVKTIHDLHLFIENIDFNKSGSSTASWIQNVDTKYQIRIQIQEKLQQLKRHIQNIDIQH
  LAGKLKQHIEAIDVRVLLDQLGTTISFERINDILEHVKHFVINLIGDFEVAEKINAFRAK
  VHELIERYEVDQQIQVLMDKLVELAHQYKLKETIQKLSNVLQQVKIKDYFEKLVGFIDDA
  VKKLNELSFKTFIEDVNKFLDMLIKKLKSFDYHQFVDETNDKIREVTQRLNGEIQALELP
  QKAEALKLFLEETKATVAVYLESLQDTKITLIINWLQEALSSASLAHMKAKFRETLEDTR
  DRMYQMDIQQELQRYLSLVGQVYSTLVTYISDWWTLAAKNLTDFAEQYSIQDWAKRMKAL
  VEQGFTVPEIKTILGTMPAFEVSLQALQKATFQTPDFIVPLTDLRIPSVQINFKDLKNIK
  IPSRFSTPEFTILNTFHIPSFTIDFVEMKVKIIRTIDQMLNSELQWPVPDIYLRDLKVED
  IPLARITLPDFRLPEIAIPEFIIPTLNLNDFQVPDLHIPEFQLPHISHTIEVPTFGKLYS
  ILKIQSPLFTLDANADIGNGTTSANEAGIAASITAKGESKLEVLNFDFQANAQLSNPKIN
  PLALKESVKFSSKYLRTEHGSEMLFFGNAIEGKSNTVASLHTEKNTLELSNGVIVKINNQ
  LTLDSNTKYFHKLNIPKLDFSSQADLRNEIKTLLKAGHIAWTSSGKGSWKWACPRFSDEG
  THESQISFTIEGPLTSFGLSNKINSKHLRVNQNLVYESGSLNFSKLEIQSQVDSQHVGHS
  VLTAKGMALFGEGKAEFTGRHDAHLNGKVIGTLKNSLFFSAQPFEITASTNNEGNLKVRF
  PLRLTGKIDFLNNYALFLSPSAQQASWQVSARFNQYKYNQNFSAGNNENIMEAHVGINGE
  ANLDFLNIPLTIPEMRLPYTIITTPPLKDFSLWEKTGLKEFLKTTKQSFDLSVKAQYKKN
  KHRHSITNPLAVLCEFISQSIKSFDRHFEKNRNNALDFVTKSYNETKIKFDKYKAEKSHD
  ELPRTFQIPGYTVPVVNVEVSPFTIEMSAFGYVFPKAVSMPSFSILGSDVRVPSYTLILP
  SLELPVLHVPRNLKLSLPDFKELCTISHIFIPAMGNITYDFSFKSSVITLNTNAELFNQS
  DIVAHLLSSSSSVIDALQYKLEGTTRLTRKRGLKLATALSLSNKFVEGSHNSTVSLTTKN
  MEVSVATTTKAQIPILRMNFKQELNGNTKSKPTVSSSMEFKYDFNSSMLYSTAKGAVDHK
  LSLESLTSYFSIESSTKGDVKGSVLSREYSGTIASEANTYLNSKSTRSSVKLQGTSKIDD
  IWNLEVKENFAGEATLQRIYSLWEHSTKNHLQLEGLFFTNGEHTSKATLELSPWQMSALV
  QVHASQPSSFHDFPDLGQEVALNANTKNQKIRWKNEVRIHSGSFQSQVELSNDQEKAHLD
  IAGSLEGHLRFLKNIILPVYDKSLWDFLKLDVTTSIGRRQHLRVSTAFVYTKNPNGYSFS
  IPVKVLADKFIIPGLKLNDLNSVLVMPTFHVPFTDLQVPSCKLDFREIQIYKKLRTSSFA
  LNLPTLPEVKFPEVDVLTKYSQPEDSLIPFFEITVPESQLTVSQFTLPKSVSDGIAALDL
  NAVANKIADFELPTIIVPEQTIEIPSIKFSVPAGIVIPSFQALTARFEVDSPVYNATWSA
  SLKNKADYVETVLDSTCSSTVQFLEYELNVLGTHKIEDGTLASKTKGTFAHRDFSAEYEE
  DGKYEGLQEWEGKAHLNIKSPAFTDLHLRYQKDKKGISTSAASPAVGTVGMDMDEDDDFS
  KWNFYYSPQSSPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV
  LYDYVNKYHWEHTGLTLREVSSKLRRNLQNNAEWVYQGAIRQIDDIDVRFQKAASGTTGT
  YQEWKDKAQNLYQELLTQEGQASFQGLKDNVFDGLVRVTQEFHMKVKHLIDSLIDFLNFP
  RFQFPGKPGIYTREELCTMFIREVGTVLSQVYSKVHNGSEILFSYFQDLVITLPFELRKH
  KLIDVISMYRELLKDLSKEAQEVFKAIQSLKTTEVLRNLQDLLQFIFQLIEDNIKQLKEM
  KFTYLINYIQDEINTIFSDYIPYVFKLLKENLCLNLHKFNEFIQNELQEASQELQQIHQY
  IMALREEYFDPSIVGWTVKYYELEEKIVSLIKNLLVALKDFHSEYIVSASNFTSQLSSQV
  EQFLHRNIQEYLSILTDPDGKGKEKIAELSATAQEIIKSQAIATKKIISDYHQQFRYKLQ
  DFSDQLSDYYEKFIAESKRLIDLSIQNYHTFLIYITELLKKLQSTTVMNPYMKLAPGELT
  IIL
• Function: Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.
• KEGG Pathway:
  Fat digestion and absorption (hsa04975)
  Vitamin digestion and absorption (hsa04977)
  Cholesterol metabolism (hsa04979)
  Lipid and atherosclerosis (hsa05417)
• Reactome Pathway:
  Scavenging by Class B Receptors (R-HSA-3000471)
  Scavenging by Class A Receptors (R-HSA-3000480)
  Scavenging by Class F Receptors (R-HSA-3000484)
  Scavenging by Class H Receptors (R-HSA-3000497)
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)
  Platelet sensitization by LDL (R-HSA-432142)
  Regulation of TLR by endogenous ligand (R-HSA-5686938)
  Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825)
  Clathrin-mediated endocytosis (R-HSA-8856828)
  VLDL assembly (R-HSA-8866423)
  Post-translational protein phosphorylation (R-HSA-8957275)
  Chylomicron assembly (R-HSA-8963888)
  Chylomicron remodeling (R-HSA-8963901)
  Chylomicron clearance (R-HSA-8964026)
  LDL clearance (R-HSA-8964038)
  LDL remodeling (R-HSA-8964041)
  VLDL clearance (R-HSA-8964046)
  Heme signaling (R-HSA-9707616)
  Retinoid metabolism and transport (R-HSA-975634)
  Cell surface interactions at the vascular wall (R-HSA-202733)

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Familial hypobetalipoproteinemia 1	DISHS3IF	Definitive	Semidominant	[1]
Hypercholesterolemia, autosomal dominant, type B	DISNFXJZ	Definitive	Autosomal dominant	[1]
Homozygous familial hypercholesterolemia	DISRCNCF	Supportive	Autosomal recessive	[2]

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Isotretinoin	DM4QTBN	Approved	Apolipoprotein B-100 (APOB) increases the Low density lipoprotein increased ADR of Isotretinoin.	[42]
Warfarin	DMJYCVW	Approved	Apolipoprotein B-100 (APOB) affects the response to substance of Warfarin.	[43]
Irbesartan	DMTP1DC	Investigative	Apolipoprotein B-100 (APOB) affects the response to substance of Irbesartan.	[44]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Apolipoprotein B-100 (APOB).	[3]
Olanzapine	DMPFN6Y	Approved	Olanzapine increases the phosphorylation of Apolipoprotein B-100 (APOB).	[22]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Apolipoprotein B-100 (APOB).	[35]

37 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Apolipoprotein B-100 (APOB).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Apolipoprotein B-100 (APOB).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Apolipoprotein B-100 (APOB).	[6]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Apolipoprotein B-100 (APOB).	[7]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Apolipoprotein B-100 (APOB).	[9]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Apolipoprotein B-100 (APOB).	[10]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Apolipoprotein B-100 (APOB).	[11]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Apolipoprotein B-100 (APOB).	[12]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Apolipoprotein B-100 (APOB).	[13]
Folic acid	DMEMBJC	Approved	Folic acid increases the expression of Apolipoprotein B-100 (APOB).	[14]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Apolipoprotein B-100 (APOB).	[13]
Simvastatin	DM30SGU	Approved	Simvastatin decreases the expression of Apolipoprotein B-100 (APOB).	[15]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid increases the expression of Apolipoprotein B-100 (APOB).	[16]
Fenofibrate	DMFKXDY	Approved	Fenofibrate decreases the expression of Apolipoprotein B-100 (APOB).	[17]
Rifampicin	DM5DSFZ	Approved	Rifampicin decreases the expression of Apolipoprotein B-100 (APOB).	[13]
Pioglitazone	DMKJ485	Approved	Pioglitazone decreases the expression of Apolipoprotein B-100 (APOB).	[18]
Hydrocortisone	DMGEMB7	Approved	Hydrocortisone decreases the expression of Apolipoprotein B-100 (APOB).	[19]
Bezafibrate	DMZDCS0	Approved	Bezafibrate decreases the expression of Apolipoprotein B-100 (APOB).	[21]
Glucosamine	DM4ZLFD	Approved	Glucosamine decreases the expression of Apolipoprotein B-100 (APOB).	[23]
Morphine	DMRMS0L	Approved	Morphine increases the expression of Apolipoprotein B-100 (APOB).	[24]
Vitamin B3	DMQVRZH	Approved	Vitamin B3 decreases the expression of Apolipoprotein B-100 (APOB).	[25]
Allopurinol	DMLPAOB	Approved	Allopurinol decreases the expression of Apolipoprotein B-100 (APOB).	[13]
Atenolol	DMNKG1Z	Approved	Atenolol increases the expression of Apolipoprotein B-100 (APOB).	[26]
Tolcapone	DM8MNVO	Approved	Tolcapone decreases the expression of Apolipoprotein B-100 (APOB).	[27]
Aluminium	DM6ECN9	Approved	Aluminium increases the expression of Apolipoprotein B-100 (APOB).	[28]
Gemfibrozil	DMD8Q3J	Approved	Gemfibrozil decreases the expression of Apolipoprotein B-100 (APOB).	[25]
Bendroflumethiazide	DM7EVLC	Approved	Bendroflumethiazide affects the expression of Apolipoprotein B-100 (APOB).	[30]
Atorvastatin	DMF28YC	Phase 3 Trial	Atorvastatin decreases the expression of Apolipoprotein B-100 (APOB).	[32]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone decreases the expression of Apolipoprotein B-100 (APOB).	[33]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Apolipoprotein B-100 (APOB).	[4]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Apolipoprotein B-100 (APOB).	[13]
Taxifolin	DMQJSF9	Preclinical	Taxifolin decreases the expression of Apolipoprotein B-100 (APOB).	[36]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Apolipoprotein B-100 (APOB).	[37]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Apolipoprotein B-100 (APOB).	[38]
Oleic acid	DM54O1Z	Investigative	Oleic acid decreases the expression of Apolipoprotein B-100 (APOB).	[39]
T0901317	DMZQVDI	Investigative	T0901317 increases the expression of Apolipoprotein B-100 (APOB).	[40]
	DMQNVR8		increases the expression of Apolipoprotein B-100 (APOB).	[41]

10 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol increases the stability of Apolipoprotein B-100 (APOB).	[8]
Indomethacin	DMSC4A7	Approved	Indomethacin decreases the secretion of Apolipoprotein B-100 (APOB).	[13]
Sulindac	DM2QHZU	Approved	Sulindac decreases the secretion of Apolipoprotein B-100 (APOB).	[13]
Lovastatin	DM9OZWQ	Approved	Lovastatin decreases the secretion of Apolipoprotein B-100 (APOB).	[20]
Indinavir	DM0T3YH	Approved	Indinavir decreases the secretion of Apolipoprotein B-100 (APOB).	[13]
Guanfacine extended release	DMB1CZ8	Approved	Guanfacine extended release affects the folding of Apolipoprotein B-100 (APOB).	[29]
BMS-201038	DMQTAGO	Approved	BMS-201038 decreases the secretion of Apolipoprotein B-100 (APOB).	[13]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the secretion of Apolipoprotein B-100 (APOB).	[31]
Granotapide	DMMZQ7V	Phase 2	Granotapide decreases the secretion of Apolipoprotein B-100 (APOB).	[34]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the secretion of Apolipoprotein B-100 (APOB).	[31]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Familial Hypercholesterolemia. 2014 Jan 2 [updated 2022 Jul 7]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [5] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [8] Estradiol enhances the resistance of LDL to oxidation by stabilizing apoB-100 conformation. Biochemistry. 2000 Nov 14;39(45):13897-903. doi: 10.1021/bi000341p.
• [9] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [10] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [11] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [12] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [13] Drug-induced hepatic steatosis in absence of severe mitochondrial dysfunction in HepaRG cells: proof of multiple mechanism-based toxicity. Cell Biol Toxicol. 2021 Apr;37(2):151-175. doi: 10.1007/s10565-020-09537-1. Epub 2020 Jun 14.
• [14] High folic acid increases cell turnover and lowers differentiation and iron content in human HT29 colon cancer cells. Br J Nutr. 2008 Apr;99(4):703-8.
• [15] Effect of simvastatin treatment on the electronegative low-density lipoprotein present in patients with heterozygous familial hypercholesterolemia. Am J Cardiol. 1999 Sep 15;84(6):655-9. doi: 10.1016/s0002-9149(99)00411-7.
• [16] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [17] Comparison of effects of bezafibrate and fenofibrate on circulating proprotein convertase subtilisin/kexin type 9 and adipocytokine levels in dyslipidemic subjects with impaired glucose tolerance or type 2 diabetes mellitus: results from a crossover study. Atherosclerosis. 2011 Jul;217(1):165-70. doi: 10.1016/j.atherosclerosis.2011.02.012. Epub 2011 Feb 22.
• [18] Combining beta-adrenergic and peroxisome proliferator-activated receptor gamma stimulation improves lipoprotein composition in healthy moderately obese subjects. Metabolism. 2006 Jan;55(1):26-34. doi: 10.1016/j.metabol.2005.06.022.
• [19] Glucocorticoid programming mechanism for hypercholesterolemia in prenatal ethanol-exposed adult offspring rats. Toxicol Appl Pharmacol. 2019 Jul 15;375:46-56.
• [20] Effect of atorvastatin, simvastatin, and lovastatin on the metabolism of cholesterol and triacylglycerides in HepG2 cells. Biochem Pharmacol. 2001 Dec 1;62(11):1545-55. doi: 10.1016/s0006-2952(01)00790-0.
• [21] Effect of bezafibrate on lipoprotein (a) and triglyceride-rich lipoproteins, including intermediate-density lipoproteins, in patients with chronic renal failure receiving haemodialysis. Nephrol Dial Transplant. 1992;7(7):623-6. doi: 10.1093/ndt/7.7.623.
• [22] Effects of olanzapine on serum protein phosphorylation patterns in patients with schizophrenia. Proteomics Clin Appl. 2015 Oct;9(9-10):907-16. doi: 10.1002/prca.201400148. Epub 2015 May 15.
• [23] Glucosamine-induced endoplasmic reticulum stress promotes ApoB100 degradation: evidence for Grp78-mediated targeting to proteasomal degradation. Arterioscler Thromb Vasc Biol. 2005 Mar;25(3):571-7. doi: 10.1161/01.ATV.0000154142.61859.94. Epub 2004 Dec 23.
• [24] Effect of opium addiction on new and traditional cardiovascular risk factors: do duration of addiction and route of administration matter?. Lipids Health Dis. 2008 Nov 3;7:42. doi: 10.1186/1476-511X-7-42.
• [25] Niacin, but not gemfibrozil, selectively increases LP-AI, a cardioprotective subfraction of HDL, in patients with low HDL cholesterol. Arterioscler Thromb Vasc Biol. 2001 Nov;21(11):1783-9. doi: 10.1161/hq1001.096624.
• [26] The effects of clonidine hydrochloride versus atenolol monotherapy on serum lipids, lipid subfractions, and apolipoproteins in mild hypertension. Am Heart J. 1990 Jul;120(1):172-9. doi: 10.1016/0002-8703(90)90175-w.
• [27] Effect of the Catechol-O-Methyltransferase Inhibitors Tolcapone and Entacapone on Fatty Acid Metabolism in HepaRG Cells. Toxicol Sci. 2018 Aug 1;164(2):477-488.
• [28] Aluminum-induced mitochondrial dysfunction leads to lipid accumulation in human hepatocytes: a link to obesity. Cell Physiol Biochem. 2007;20(5):627-38. doi: 10.1159/000107546.
• [29] Increased plasma concentrations of palmitoylethanolamide, an endogenous fatty acid amide, affect oxidative damage of human low-density lipoproteins: an in vitro study. Atherosclerosis. 2005 Sep;182(1):47-55. doi: 10.1016/j.atherosclerosis.2005.01.043.
• [30] Relation between dose of bendrofluazide, antihypertensive effect, and adverse biochemical effects. BMJ. 1990 Apr 14;300(6730):975-8. doi: 10.1136/bmj.300.6730.975.
• [31] Red wine polyphenolics increase LDL receptor expression and activity and suppress the secretion of ApoB100 from human HepG2 cells. J Nutr. 2003 Mar;133(3):700-6. doi: 10.1093/jn/133.3.700.
• [32] Use of atorvastatin in hyperlipidemic hypertensive renal transplant recipients. Pediatr Nephrol. 2002 Jul;17(7):540-3. doi: 10.1007/s00467-002-0860-z. Epub 2002 May 25.
• [33] Hepatic cells derived from human skin progenitors show a typical phospholipidotic response upon exposure to amiodarone. Toxicol Lett. 2018 Mar 1;284:184-194. doi: 10.1016/j.toxlet.2017.11.014. Epub 2017 Dec 15.
• [34] Pharmacological characterization of diethyl-2-({3-dimethylcarbamoyl-4-[(4'-trifluoromethylbiphenyl-2-carbonyl)amino]phenyl}acetyloxymethyl)-2-phenylmalonate (JTT-130), an intestine-specific inhibitor of microsomal triglyceride transfer protein. J Pharmacol Exp Ther. 2011 Feb;336(2):321-7. doi: 10.1124/jpet.110.173807. Epub 2010 Oct 25.
• [35] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [36] Modulation of hepatic lipoprotein synthesis and secretion by taxifolin, a plant flavonoid. J Lipid Res. 2000 Dec;41(12):1969-79.
• [37] Downregulation of miR-192 causes hepatic steatosis and lipid accumulation by inducing SREBF1: Novel mechanism for bisphenol A-triggered non-alcoholic fatty liver disease. Biochim Biophys Acta Mol Cell Biol Lipids. 2017 Sep;1862(9):869-882. doi: 10.1016/j.bbalip.2017.05.001. Epub 2017 May 5.
• [38] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [39] Farnesol induces fatty acid oxidation and decreases triglyceride accumulation in steatotic HepaRG cells. Toxicol Appl Pharmacol. 2019 Feb 15;365:61-70.
• [40] Editor's Highlight: Mechanistic Toxicity Tests Based on an Adverse Outcome Pathway Network for Hepatic Steatosis. Toxicol Sci. 2017 Sep 1;159(1):159-169. doi: 10.1093/toxsci/kfx121.
• [41] Small dense LDL and atherogenic lipid profile in HIV-positive adults: influence of lopinavir/ritonavir-containing regimen. AIDS. 2003 Mar 28;17(5):772-4. doi: 10.1097/00002030-200303280-00023.
• [42] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
• [43] APOB gene polymorphisms may affect the risk of minor or minimal bleeding complications in patients on warfarin maintaining therapeutic INR. Eur J Hum Genet. 2019 Oct;27(10):1542-1549. doi: 10.1038/s41431-019-0450-1. Epub 2019 Jun 11.
• [44] Single nucleotide polymorphisms in the apolipoprotein B and low density lipoprotein receptor genes affect response to antihypertensive treatment. BMC Cardiovasc Disord. 2004 Sep 28;4(1):16. doi: 10.1186/1471-2261-4-16.