Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTILK3Q7)

• DOT Name: AT-rich interactive domain-containing protein 1B (ARID1B)
• Synonyms: ARID domain-containing protein 1B; BRG1-associated factor 250b; BAF250B; BRG1-binding protein hELD/OSA1; Osa homolog 2; hOsa2; p250R
• Gene Name: ARID1B
• Related Disease:
  Coffin-Siris syndrome
  Coffin-Siris syndrome 1
  Intellectual disability-sparse hair-brachydactyly syndrome
  Acute monocytic leukemia
  Advanced cancer
  Autism spectrum disorder
  Bladder cancer
  Bladder transitional cell carcinoma
  Chromosome 6q24-q25 deletion syndrome
  Colorectal carcinoma
  Congenital laryngomalacia
  Congestive heart failure
  Epilepsy
  Hepatocellular carcinoma
  High blood pressure
  Hypoglycemia
  Intellectual disability
  Lung adenocarcinoma
  Malignant neoplasm
  Movement disorder
  Neoplasm
  Neurofibroma
  Non-insulin dependent diabetes
  Obstructive sleep apnea
  Pancreatic cancer
  Pathologic nystagmus
  Polycystic ovarian syndrome
  Promyelocytic leukaemia
  Triple negative breast cancer
  Tuberculosis
  Urinary bladder cancer
  Urinary bladder neoplasm
  Vesicoureteral reflux
  Achondroplasia
  Autism
  Carcinoma
  Endometrial carcinoma
  Hypertrichosis
  Neuroblastoma
  Undifferentiated carcinoma
  Acute myelogenous leukaemia
  Corpus callosum, agenesis of
  Hirschsprung disease
  Ischemia
  Pervasive developmental disorder
• UniProt ID: ARI1B_HUMAN
• PDB ID: 2CXY; 2EH9
• Pfam ID: PF01388 ; PF12031
• Sequence:
  MAARAAAAAAAAAARARARAGSGERRAPPGPRPAPGARDLEAGARGAAAAAAAPGPMLGG
  GGDGGGGLNSVHHHPLLPRHELNMAHNAGAAAAAGTHSAKSGGSEAALKEGGSAAALSSS
  SSSSAAAAAASSSSSSGPGSAMETGLLPNHKLKTVGEAPAAPPHQQHHHHHHAHHHHHHA
  HHLHHHHALQQQLNQFQQQQQQQQQQQQQQQQQQHPISNNNSLGGAGGGAPQPGPDMEQP
  QHGGAKDSAAGGQADPPGPPLLSKPGDEDDAPPKMGEPAGGRYEHPGLGALGTQQPPVAV
  PGGGGGPAAVPEFNNYYGSAAPASGGPGGRAGPCFDQHGGQQSPGMGMMHSASAAAAGAP
  GSMDPLQNSHEGYPNSQCNHYPGYSRPGAGGGGGGGGGGGGGSGGGGGGGGAGAGGAGAG
  AVAAAAAAAAAAAGGGGGGGYGGSSAGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAGS
  AAGGFQRFAGQNQHPSGATPTLNQLLTSPSPMMRSYGGSYPEYSSPSAPPPPPSQPQSQA
  AAAGAAAGGQQAAAGMGLGKDMGAQYAAASPAWAAAQQRSHPAMSPGTPGPTMGRSQGSP
  MDPMVMKRPQLYGMGSNPHSQPQQSSPYPGGSYGPPGPQRYPIGIQGRTPGAMAGMQYPQ
  QQMPPQYGQQGVSGYCQQGQQPYYSQQPQPPHLPPQAQYLPSQSQQRYQPQQDMSQEGYG
  TRSQPPLAPGKPNHEDLNLIQQERPSSLPDLSGSIDDLPTGTEATLSSAVSASGSTSSQG
  DQSNPAQSPFSPHASPHLSSIPGGPSPSPVGSPVGSNQSRSGPISPASIPGSQMPPQPPG
  SQSESSSHPALSQSPMPQERGFMAGTQRNPQMAQYGPQQTGPSMSPHPSPGGQMHAGISS
  FQQSNSSGTYGPQMSQYGPQGNYSRPPAYSGVPSASYSGPGPGMGISANNQMHGQGPSQP
  CGAVPLGRMPSAGMQNRPFPGNMSSMTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVM
  QAAANSAQSRQGSFPGMNQSGLMASSSPYSQPMNNSSSLMNTQAPPYSMAPAMVNSSAAS
  VGLADMMSPGESKLPLPLKADGKEEGTPQPESKSKKSSSSTTTGEKITKVYELGNEPERK
  LWVDRYLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLN
  VGTSSSAASSLKKQYIQYLFAFECKIERGEEPPPEVFSTGDTKKQPKLQPPSPANSGSLQ
  GPQTPQSTGSNSMAEVPGDLKPPTPASTPHGQMTPMQGGRSSTISVHDPFSDVSDSSFPK
  RNSMTPNAPYQQGMSMPDVMGRMPYEPNKDPFGGMRKVPGSSEPFMTQGQMPNSSMQDMY
  NQSPSGAMSNLGMGQRQQFPYGASYDRRHEPYGQQYPGQGPPSGQPPYGGHQPGLYPQQP
  NYKRHMDGMYGPPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRE
  RMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNRQGPGGPTQAPPY
  PGMNRTDDMMVPDQRINHESQWPSHVSQRQPYMSSSASMQPITRPPQPSYQTPPSLPNHI
  SRAPSPASFQRSLENRMSPSKSPFLPSMKMQKVMPTVPTSQVTGPPPQPPPIRREITFPP
  GSVEASQPVLKQRRKITSKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVAT
  FNLSQLSGFLELLVEYFRKCLIDIFGILMEYEVGDPSQKALDHNAARKDDSQSLADDSGK
  EEEDAECIDDDEEDEEDEEEDSEKTESDEKSSIALTAPDAAADPKEKPKQASKFDKLPIK
  IVKKNNLFVVDRSDKLGRVQEFNSGLLHWQLGGGDTTEHIQTHFESKMEIPPRRRPPPPL
  SSAGRKKEQEGKGDSEEQQEKSIIATIDDVLSARPGALPEDANPGPQTESSKFPFGIQQA
  KSHRNIKLLEDEPRSRDETPLCTIAHWQDSLAKRCICVSNIVRSLSFVPGNDAEMSKHPG
  LVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLAN
  ISGQLDLSAYTESICLPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLS
  IQDNNVDLILATPPFSRQEKFYATLVRYVGDRKNPVCREMSMALLSNLAQGDALAARAIA
  VQKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQPPPLEPPSVDMMCRAAKALLAMARVDE
  NRSEFLLHEGRLLDISISAVLNSLVASVICDVLFQIGQL
• Function: Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. Binds DNA non-specifically.
• Tissue Specificity: Widely expressed with high levels in heart, skeletal muscle and kidney.
• KEGG Pathway:
  ATP-dependent chromatin remodeling (hsa03082)
  Thermogenesis (hsa04714)
  Hepatocellular carcinoma (hsa05225)
• Reactome Pathway:
  RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known (R-HSA-8939243)
  RMTs methylate histone arginines (R-HSA-3214858)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Coffin-Siris syndrome	DIS8L03H	Definitive	Autosomal dominant	[1]
Coffin-Siris syndrome 1	DIS95FRP	Definitive	Autosomal dominant	[2]
Intellectual disability-sparse hair-brachydactyly syndrome	DISEB2FS	Definitive	Biomarker	[3]
Acute monocytic leukemia	DIS28NEL	Strong	Biomarker	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Autism spectrum disorder	DISXK8NV	Strong	Genetic Variation	[6]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[7]
Bladder transitional cell carcinoma	DISNL46A	Strong	Altered Expression	[7]
Chromosome 6q24-q25 deletion syndrome	DISORHM4	Strong	ChromosomalRearrangement	[8]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[9]
Congenital laryngomalacia	DISWQG9L	Strong	CausalMutation	[10]
Congestive heart failure	DIS32MEA	Strong	Genetic Variation	[11]
Epilepsy	DISBB28L	Strong	Biomarker	[12]
Hepatocellular carcinoma	DIS0J828	Strong	Genetic Variation	[13]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[14]
Hypoglycemia	DISRCKR7	Strong	Genetic Variation	[15]
Intellectual disability	DISMBNXP	Strong	Biomarker	[16]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[17]
Malignant neoplasm	DISS6SNG	Strong	Genetic Variation	[18]
Movement disorder	DISOJJ2D	Strong	CausalMutation	[19]
Neoplasm	DISZKGEW	Strong	Biomarker	[20]
Neurofibroma	DISIJJMH	Strong	Biomarker	[21]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[15]
Obstructive sleep apnea	DIS0SVD1	Strong	Biomarker	[22]
Pancreatic cancer	DISJC981	Strong	Biomarker	[23]
Pathologic nystagmus	DIS1QSPO	Strong	CausalMutation	[10]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Genetic Variation	[24]
Promyelocytic leukaemia	DISYGG13	Strong	Biomarker	[25]
Triple negative breast cancer	DISAMG6N	Strong	Altered Expression	[26]
Tuberculosis	DIS2YIMD	Strong	Genetic Variation	[27]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[7]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[7]
Vesicoureteral reflux	DISUL6SA	Strong	CausalMutation	[10]
Achondroplasia	DISYWN2O	moderate	Biomarker	[28]
Autism	DISV4V1Z	moderate	Genetic Variation	[29]
Carcinoma	DISH9F1N	moderate	Altered Expression	[30]
Endometrial carcinoma	DISXR5CY	moderate	Altered Expression	[31]
Hypertrichosis	DISZUK5W	moderate	Biomarker	[32]
Neuroblastoma	DISVZBI4	moderate	Genetic Variation	[33]
Undifferentiated carcinoma	DISIAZST	moderate	Genetic Variation	[31]
Acute myelogenous leukaemia	DISCSPTN	Limited	Biomarker	[4]
Corpus callosum, agenesis of	DISO9P40	Limited	Genetic Variation	[29]
Hirschsprung disease	DISUUSM1	Limited	Biomarker	[34]
Ischemia	DIS5XOOY	Limited	Biomarker	[35]
Pervasive developmental disorder	DIS51975	Limited	Genetic Variation	[6]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of AT-rich interactive domain-containing protein 1B (ARID1B).	[36]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of AT-rich interactive domain-containing protein 1B (ARID1B).	[41]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of AT-rich interactive domain-containing protein 1B (ARID1B).	[37]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of AT-rich interactive domain-containing protein 1B (ARID1B).	[38]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of AT-rich interactive domain-containing protein 1B (ARID1B).	[39]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of AT-rich interactive domain-containing protein 1B (ARID1B).	[40]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of AT-rich interactive domain-containing protein 1B (ARID1B).	[42]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of AT-rich interactive domain-containing protein 1B (ARID1B).	[43]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of AT-rich interactive domain-containing protein 1B (ARID1B).	[44]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] The ARID1B spectrum in 143 patients: from nonsyndromic intellectual disability to Coffin-Siris syndrome. Genet Med. 2019 Jun;21(6):1295-1307. doi: 10.1038/s41436-018-0330-z. Epub 2018 Nov 8.
• [3] Striking phenotypic overlap between Nicolaides-Baraitser and Coffin-Siris syndromes in monozygotic twins with ARID1B intragenic deletion.Eur J Med Genet. 2020 Mar;63(3):103739. doi: 10.1016/j.ejmg.2019.103739. Epub 2019 Aug 14.
• [4] Glasdegib plus intensive/nonintensive chemotherapy in untreated acute myeloid leukemia: BRIGHT AML 1019 Phase III trials.Future Oncol. 2019 Nov;15(31):3531-3545. doi: 10.2217/fon-2019-0373. Epub 2019 Sep 13.
• [5] A potentially functional variant of ARID1B interacts with physical activity in association with risk of hepatocellular carcinoma.Oncotarget. 2017 May 9;8(19):31057-31064. doi: 10.18632/oncotarget.16074.
• [6] The role of ARID1B, a BAF chromatin remodeling complex subunit, in neural development and behavior.Prog Neuropsychopharmacol Biol Psychiatry. 2019 Mar 8;89:30-38. doi: 10.1016/j.pnpbp.2018.08.021. Epub 2018 Aug 24.
• [7] Expression of ARID1B Is Associated With Poor Outcomes and Predicts the Benefit from Adjuvant Chemotherapy in Bladder Urothelial Carcinoma.J Cancer. 2017 Sep 27;8(17):3490-3497. doi: 10.7150/jca.19109. eCollection 2017.
• [8] Haploinsufficiency of ARID1B, a member of the SWI/SNF-a chromatin-remodeling complex, is a frequent cause of intellectual disability.Am J Hum Genet. 2012 Mar 9;90(3):565-72. doi: 10.1016/j.ajhg.2012.02.007.
• [9] Targeting ARID1A-mutant colorectal cancer: depletion of ARID1B increases radiosensitivity and modulates DNA damage response.Sci Rep. 2019 Dec 3;9(1):18207. doi: 10.1038/s41598-019-54757-z.
• [10] Targeted Next-Generation Sequencing Analysis of 1,000 Individuals with Intellectual Disability.Hum Mutat. 2015 Dec;36(12):1197-204. doi: 10.1002/humu.22901. Epub 2015 Sep 30.
• [11] Effects of carvedilol vs bisoprolol on inflammation and oxidative stress in patients with chronic heart failure.J Cardiol. 2020 Feb;75(2):140-147. doi: 10.1016/j.jjcc.2019.07.011. Epub 2019 Aug 21.
• [12] De novo variants in neurodevelopmental disorders with epilepsy.Nat Genet. 2018 Jul;50(7):1048-1053. doi: 10.1038/s41588-018-0143-7. Epub 2018 Jun 25.
• [13] A system for detecting high impact-low frequency mutations in primary tumors and metastases.Oncogene. 2018 Jan 11;37(2):185-196. doi: 10.1038/onc.2017.322. Epub 2017 Sep 11.
• [14] Genome-wide scan identifies CDH13 as a novel susceptibility locus contributing to blood pressure determination in two European populations.Hum Mol Genet. 2009 Jun 15;18(12):2288-96. doi: 10.1093/hmg/ddp135. Epub 2009 Mar 20.
• [15] Similar glycaemic control and less hypoglycaemia during active titration after insulin initiation with glargine 300 units/mL and degludec 100 units/mL: A subanalysis of the BRIGHT study.Diabetes Obes Metab. 2020 Mar;22(3):346-354. doi: 10.1111/dom.13901. Epub 2019 Dec 20.
• [16] Correction: The ARID1B spectrum in 143 patients: from nonsyndromic intellectual disability to Coffin-Siris syndrome.Genet Med. 2019 Sep;21(9):2160-2161. doi: 10.1038/s41436-018-0368-y.
• [17] Prognosis related miRNAs, DNA methylation, and epigenetic interactions in lung adenocarcinoma.Neoplasma. 2019 May 23;66(3):487-493. doi: 10.4149/neo_2018_181029N805. Epub 2019 Mar 7.
• [18] Integrated genomic analyses identify ARID1A and ARID1B alterations in the childhood cancer neuroblastoma.Nat Genet. 2013 Jan;45(1):12-7. doi: 10.1038/ng.2493. Epub 2012 Dec 2.
• [19] De novo missense variants in HECW2 are associated with neurodevelopmental delay and hypotonia. J Med Genet. 2017 Feb;54(2):84-86. doi: 10.1136/jmedgenet-2016-103943. Epub 2016 Jul 7.
• [20] Next-generation Sequencing Reveals Recurrent Somatic Mutations in Small Cell Neuroendocrine Carcinoma of the Uterine Cervix.Am J Surg Pathol. 2018 Jun;42(6):750-760. doi: 10.1097/PAS.0000000000001042.
• [21] Insertional Mutagenesis Identifies a STAT3/Arid1b/-catenin Pathway Driving Neurofibroma Initiation.Cell Rep. 2016 Mar 1;14(8):1979-90. doi: 10.1016/j.celrep.2016.01.074. Epub 2016 Feb 18.
• [22] Oxidative Stress Markers and Severity of Obstructive Sleep Apnea.Adv Exp Med Biol. 2019;1222:27-35. doi: 10.1007/5584_2019_433.
• [23] ARID1B, a member of the human SWI/SNF chromatin remodeling complex, exhibits tumour-suppressor activities in pancreatic cancer cell lines.Br J Cancer. 2013 May 28;108(10):2056-62. doi: 10.1038/bjc.2013.200. Epub 2013 May 9.
• [24] Coffin-Siris Syndrome with obesity, macrocephaly, hepatomegaly and hyperinsulinism caused by a mutation in the ARID1B gene.Eur J Hum Genet. 2014 Nov;22(11):1327-9. doi: 10.1038/ejhg.2014.25. Epub 2014 Feb 26.
• [25] Comprehensive mutational analysis of primary and relapse acute promyelocytic leukemia.Leukemia. 2016 Aug;30(8):1672-81. doi: 10.1038/leu.2016.69. Epub 2016 Apr 11.
• [26] Upregulated expression of AT-rich interactive domain-containing protein 1B predicts poor prognosis in patients with triple-negative breast cancer.Oncol Lett. 2019 Mar;17(3):3289-3295. doi: 10.3892/ol.2019.9961. Epub 2019 Jan 23.
• [27] Noninvasive Detection of Tuberculosis by Oral Swab Analysis.J Clin Microbiol. 2019 Feb 27;57(3):e01847-18. doi: 10.1128/JCM.01847-18. Print 2019 Mar.
• [28] Subcranial and orthognathic surgery for obstructive sleep apnea in achondroplasia.J Craniomaxillofac Surg. 2017 Dec;45(12):2028-2034. doi: 10.1016/j.jcms.2017.09.028. Epub 2017 Oct 5.
• [29] Corpus callosum metrics predict severity of visuospatial and neuromotor dysfunctions in ARID1B mutations with Coffin-Siris syndrome.Psychiatr Genet. 2019 Dec;29(6):237-242. doi: 10.1097/YPG.0000000000000225.
• [30] Concurrent ARID1A and ARID1B inactivation in endometrial and ovarian dedifferentiated carcinomas.Mod Pathol. 2016 Dec;29(12):1586-1593. doi: 10.1038/modpathol.2016.156. Epub 2016 Aug 26.
• [31] Undifferentiated Endometrial Carcinomas Show Frequent Loss of Core Switch/Sucrose Nonfermentable Complex Proteins.Am J Surg Pathol. 2018 Jan;42(1):76-83. doi: 10.1097/PAS.0000000000000941.
• [32] Expanding the phenotypic spectrum of ARID1B-mediated disorders and identification of altered cell-cycle dynamics due to ARID1B haploinsufficiency. Orphanet J Rare Dis. 2014 Mar 27;9:43. doi: 10.1186/1750-1172-9-43.
• [33] ARID1B alterations identify aggressive tumors in neuroblastoma.Oncotarget. 2017 Jul 11;8(28):45943-45950. doi: 10.18632/oncotarget.17500.
• [34] Hirschsprung disease as a yet undescribed phenotype in a patient with ARID1B mutation.Am J Med Genet A. 2016 Dec;170(12):3249-3252. doi: 10.1002/ajmg.a.37861. Epub 2016 Aug 11.
• [35] Ischemia induces early expression of a new transcription factor (6A3-5) in kidney vascular smooth muscle cells: studies in rat and human renal pathology.Am J Pathol. 2003 Dec;163(6):2485-94. doi: 10.1016/S0002-9440(10)63603-6.
• [36] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [37] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [38] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [39] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [40] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [41] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [42] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [43] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [44] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.