Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJUGPK0)

• DOT Name: Glycerol-3-phosphate acyltransferase 3 (GPAT3)
• Synonyms: GPAT-3; EC 2.3.1.15; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 10; AGPAT 10; 1-acyl-sn-glycerol-3-phosphate O-acyltransferase 9; 1-AGP acyltransferase 9; 1-AGPAT 9; EC 2.3.1.51; Acyl-CoA:glycerol-3-phosphate acyltransferase 3; hGPAT3; Lung cancer metastasis-associated protein 1; Lysophosphatidic acid acyltransferase theta; LPAAT-theta; MAG-1
• Gene Name: GPAT3
• Related Disease:
  Acquired immune deficiency syndrome
  Endometritis
  Metastatic malignant neoplasm
  Neoplasm
  Obesity
  Acute myelogenous leukaemia
  Breast cancer
  Breast carcinoma
• UniProt ID: GPAT3_HUMAN
• EC Number: 2.3.1.15; 2.3.1.51
• Pfam ID: PF01553
• Sequence:
  MEGAELAGKILSTWLTLVLGFILLPSVFGVSLGISEIYMKILVKTLEWATIRIEKGTPKE
  SILKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEE
  LVSWNLLTRTNVNFQYISLRLTMVWVLGVIVRYCVLLPLRVTLAFIGISLLVIGTTLVGQ
  LPDSSLKNWLSELVHLTCCRICVRALSGTIHYHNKQYRPQKGGICVANHTSPIDVLILTT
  DGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRHLVTKRLKEHIADKKKLPILI
  FPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMVSYLLRMMTSW
  AIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQ
  KNYSKMIVGNGSLS
• Function: Converts glycerol-3-phosphate to 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) by incorporating an acyl moiety at the sn-1 position of the glycerol backbone. Also converts LPA into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. Protects cells against lipotoxicity.
• Tissue Specificity: Widely expressed. Expressed in liver, kidney, testis, brain, heart, skeletal muscle, thyroid, prostate, thymus and placenta. Also expressed lung and adipose tissue.
• KEGG Pathway:
  Glycerolipid metabolism (hsa00561)
  Glycerophospholipid metabolism (hsa00564)
  Metabolic pathways (hsa01100)
• Reactome Pathway: Synthesis of PA (R-HSA-1483166)

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acquired immune deficiency syndrome	DISL5UOX	Strong	Biomarker	[1]
Endometritis	DISHGJ6G	Strong	Biomarker	[2]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[3]
Neoplasm	DISZKGEW	Strong	Biomarker	[3]
Obesity	DIS47Y1K	Strong	Biomarker	[4]
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[5]
Breast cancer	DIS7DPX1	Limited	Biomarker	[6]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[6]

41 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[7]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[8]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[9]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[10]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[11]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[12]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[8]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[13]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[14]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[15]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[16]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[17]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[18]
Menadione	DMSJDTY	Approved	Menadione increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[16]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[19]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[20]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[21]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[22]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[21]
Fenofibrate	DMFKXDY	Approved	Fenofibrate increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[21]
Ifosfamide	DMCT3I8	Approved	Ifosfamide increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[21]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[21]
Ibuprofen	DM8VCBE	Approved	Ibuprofen increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[21]
Lindane	DMB8CNL	Approved	Lindane increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[22]
Vitamin C	DMXJ7O8	Approved	Vitamin C increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[22]
Ampicillin	DMHWE7P	Approved	Ampicillin decreases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[14]
Phenol	DM1QSM3	Phase 2/3	Phenol increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[22]
DNCB	DMDTVYC	Phase 2	DNCB affects the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[23]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[22]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[24]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[25]
Eugenol	DM7US1H	Patented	Eugenol increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[22]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[26]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[27]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[28]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[29]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride affects the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[23]
CH-223191	DMMJZYC	Investigative	CH-223191 decreases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[30]
Oleic acid	DM54O1Z	Investigative	Oleic acid increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[31]
GW7647	DM9RD0C	Investigative	GW7647 increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[31]
CITCO	DM0N634	Investigative	CITCO increases the expression of Glycerol-3-phosphate acyltransferase 3 (GPAT3).	[31]

References

• [1] Efficacy of a novel reverse transcriptase-polymerase chain reaction (RT-PCR) for detecting Toxoplasma gondii bradyzoite gene expression in human clinical specimens.Mol Cell Probes. 2002 Feb;16(1):31-9. doi: 10.1006/mcpr.2001.0394.
• [2] Genomic breeding values, SNP effects and gene identification for disease traits in cow training sets.Anim Genet. 2018 Jun;49(3):178-192. doi: 10.1111/age.12661. Epub 2018 Apr 6.
• [3] Metastasis-associated gene, mag-1 improves tumour microenvironmental adaptation and potentiates tumour metastasis.J Cell Mol Med. 2012 Dec;16(12):3037-51. doi: 10.1111/j.1582-4934.2012.01633.x.
• [4] Molecular identification of microsomal acyl-CoA:glycerol-3-phosphate acyltransferase, a key enzyme in de novo triacylglycerol synthesis.Proc Natl Acad Sci U S A. 2006 Dec 26;103(52):19695-700. doi: 10.1073/pnas.0609140103. Epub 2006 Dec 14.
• [5] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [6] AGPAT9 suppresses cell growth, invasion and metastasis by counteracting acidic tumor microenvironment through KLF4/LASS2/V-ATPase signaling pathway in breast cancer.Oncotarget. 2015 Jul 30;6(21):18406-17. doi: 10.18632/oncotarget.4074.
• [7] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [8] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [9] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [10] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [11] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [12] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [13] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [14] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [15] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [16] Time series analysis of oxidative stress response patterns in HepG2: a toxicogenomics approach. Toxicology. 2013 Apr 5;306:24-34.
• [17] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [18] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [19] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [20] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [21] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [22] Oxidative stress mechanisms do not discriminate between genotoxic and nongenotoxic liver carcinogens. Chem Res Toxicol. 2015 Aug 17;28(8):1636-46.
• [23] Preliminary discovery of novel markers for human cell line activation test (h-CLAT). Toxicol In Vitro. 2021 Aug;74:105154. doi: 10.1016/j.tiv.2021.105154. Epub 2021 Mar 25.
• [24] Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
• [25] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [26] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [27] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [28] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [29] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
• [30] The Ah receptor regulates growth factor expression in head and neck squamous cell carcinoma cell lines. Mol Carcinog. 2014 Oct;53(10):765-76.
• [31] Farnesol induces fatty acid oxidation and decreases triglyceride accumulation in steatotic HepaRG cells. Toxicol Appl Pharmacol. 2019 Feb 15;365:61-70.