Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKCR5XL)

• DOT Name: Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1)
• Synonyms: CaMKII inhibitory protein alpha; CaMKIIN-alpha
• Gene Name: CAMK2N1
• Related Disease:
  Bone osteosarcoma
  Coronary atherosclerosis
  Coronary heart disease
  Epithelial ovarian cancer
  Metastatic prostate carcinoma
  Neoplasm
  Non-insulin dependent diabetes
  Osteosarcoma
  Plasma cell myeloma
  Prostate cancer
  Prostate carcinoma
  Castration-resistant prostate carcinoma
• UniProt ID: CK2N1_HUMAN
• Pfam ID: PF15170
• Sequence:
  MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIED
  DRIDDVLKNMTDKAPPGV
• Function: Potent and specific inhibitor of CaM-kinase II (CAMK2). Plays a role in the maintenance of long-term retrieval-induced memory in response to contextual fear. Modulates blood pressure and vascular reactivity via regulation of CAMK2 activity in addition to regulation of left ventricular mass. Mediates the NLRP3 inflammasome in cardiomyocytes via acting as an inhibitor of the MAPK14/p38 and MAPK8/JNK pathways, thereby regulating ventricular remodeling and cardiac rhythm post-myocardial infarction. Negatively effects insulin sensitivity and promotes lipid formation in adipose tissues independent of CAMK2 signaling.

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bone osteosarcoma	DIST1004	Strong	Biomarker	[1]
Coronary atherosclerosis	DISKNDYU	Strong	Altered Expression	[2]
Coronary heart disease	DIS5OIP1	Strong	Altered Expression	[2]
Epithelial ovarian cancer	DIS56MH2	Strong	Posttranslational Modification	[3]
Metastatic prostate carcinoma	DISVBEZ9	Strong	Altered Expression	[4]
Neoplasm	DISZKGEW	Strong	Biomarker	[5]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Altered Expression	[2]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[1]
Plasma cell myeloma	DIS0DFZ0	moderate	Biomarker	[6]
Prostate cancer	DISF190Y	moderate	Altered Expression	[4]
Prostate carcinoma	DISMJPLE	moderate	Altered Expression	[4]
Castration-resistant prostate carcinoma	DISVGAE6	Limited	Biomarker	[7]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitoxantrone	DMM39BF	Approved	Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1) affects the response to substance of Mitoxantrone.	[32]

24 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[8]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[9]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[10]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[11]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[12]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[13]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[14]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[15]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[16]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[17]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[18]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[19]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[20]
Cytarabine	DMZD5QR	Approved	Cytarabine increases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[22]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[23]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[24]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[13]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[25]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[26]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[13]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[28]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[29]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[30]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde decreases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[31]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[21]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1).	[27]

References

• [1] MicroRNA profiling with correlation to gene expression revealed the oncogenic miR-17-92 cluster to be up-regulated in osteosarcoma.Cancer Genet. 2012 May;205(5):212-9. doi: 10.1016/j.cancergen.2012.03.001.
• [2] Camk2n1 Is a Negative Regulator of Blood Pressure, Left Ventricular Mass, Insulin Sensitivity, and Promotes Adiposity.Hypertension. 2019 Sep;74(3):687-696. doi: 10.1161/HYPERTENSIONAHA.118.12409. Epub 2019 Jul 22.
• [3] RUNX3 and CAMK2N1 hypermethylation as prognostic marker for epithelial ovarian cancer.Int J Cancer. 2016 Jan 1;138(1):217-28. doi: 10.1002/ijc.29690. Epub 2015 Jul 28.
• [4] Expression of EMT-Related Genes CAMK2N1 and WNT5A is increased in Locally Invasive and Metastatic Prostate Cancer.J Cancer. 2019 Oct 15;10(24):5915-5925. doi: 10.7150/jca.34564. eCollection 2019.
• [5] Functional Analyses of RUNX3 and CaMKIIN in Ovarian Cancer Cell Lines Reveal Tumor-Suppressive Functions for CaMKIIN and Dichotomous Roles for RUNX3 Transcript Variants.Int J Mol Sci. 2018 Jan 15;19(1):253. doi: 10.3390/ijms19010253.
• [6] MicroRNA-532 exerts oncogenic functions in t(4;14) multiple myeloma by targeting CAMK2N1.Hum Cell. 2019 Oct;32(4):529-539. doi: 10.1007/s13577-019-00276-y. Epub 2019 Aug 26.
• [7] The tumor suppressive role of CAMK2N1 in castration-resistant prostate cancer.Oncotarget. 2014 Jun 15;5(11):3611-21. doi: 10.18632/oncotarget.1968.
• [8] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [9] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [10] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [11] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [12] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [13] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [14] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [15] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [16] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [17] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [18] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [19] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [20] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [21] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [22] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [23] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [24] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [25] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [26] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [27] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [28] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [29] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [30] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [31] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [32] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.