Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKDEEYX)

• DOT Name: Vigilin (HDLBP)
• Synonyms: High density lipoprotein-binding protein; HDL-binding protein
• Gene Name: HDLBP
• Related Disease:
  Coronary heart disease
  Familial lipoprotein lipase deficiency
  Neoplasm
  Non-insulin dependent diabetes
  Small lymphocytic lymphoma
  2q37 microdeletion syndrome
  Abscess
  Advanced cancer
  Alzheimer disease
  Arteriosclerosis
  Atherosclerosis
  Autism
  Bacterial meningitis
  Breast cancer
  Breast carcinoma
  Cardiovascular disease
  Chronic obstructive pulmonary disease
  Congestive heart failure
  Diabetic kidney disease
  Fatty liver disease
  Graves disease
  Hepatocellular carcinoma
  Intrahepatic cholangiocarcinoma
  Liver cirrhosis
  Small-cell lung cancer
  Toxic epidermal necrolysis
  Bacterial infection
  Ductal breast carcinoma in situ
  Prostate cancer
• UniProt ID: VIGLN_HUMAN
• PDB ID: 1VIG; 1VIH; 2CTE; 2CTF; 2CTJ; 2CTK; 2CTL; 2CTM
• Pfam ID: PF00013
• Sequence:
  MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEKAACLESAQEP
  AGAWGNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQAKICLEIMQRTGAHLELSLA
  KDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKT
  ATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGP
  YNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTTIAV
  EVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEVYAK
  ANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVA
  QEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNL
  IRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEV
  IINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKG
  GANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSI
  PAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLA
  EEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARVIFPAAEDKDQDLITIIGKE
  DAVREAQKELEALIQNLDNVVEDSMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRS
  GTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTLECAIPQKFHRSVMGPKGSRIQQIT
  RDFSVQIKFPDREENAVHSTEPVVQENGDEAGEGREAKDCDPGSPRRCDIIIISGRKEKC
  EAAKEALEALVPVTIEVEVPFDLHRYVIGQKGSGIRKMMDEFEVNIHVPAPELQSDIIAI
  TGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRL
  EHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMVSEDVPLDHRVHA
  RIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLAD
  VVDSEALQVYMKPPAHEEAKAPSRGFVVRDAPWTASSSEKAPDMSSSEEFPSFGAQVAPK
  TLPWGPKR
• Function: Appears to play a role in cell sterol metabolism. It may function to protect cells from over-accumulation of cholesterol.
• Reactome Pathway: HDL clearance (R-HSA-8964011)

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Coronary heart disease	DIS5OIP1	Definitive	Biomarker	[1]
Familial lipoprotein lipase deficiency	DIS0M7NJ	Definitive	Genetic Variation	[1]
Neoplasm	DISZKGEW	Definitive	Biomarker	[2]
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Biomarker	[3]
Small lymphocytic lymphoma	DIS30POX	Definitive	Genetic Variation	[4]
2q37 microdeletion syndrome	DISZYHCB	Strong	Biomarker	[5]
Abscess	DISAP982	Strong	Biomarker	[6]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[7]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[8]
Arteriosclerosis	DISK5QGC	Strong	Altered Expression	[9]
Atherosclerosis	DISMN9J3	Strong	Altered Expression	[9]
Autism	DISV4V1Z	Strong	Biomarker	[5]
Bacterial meningitis	DISRP9SL	Strong	Altered Expression	[10]
Breast cancer	DIS7DPX1	Strong	Biomarker	[11]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[11]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[12]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Biomarker	[13]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[13]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[14]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[15]
Graves disease	DISU4KOQ	Strong	Biomarker	[16]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[17]
Intrahepatic cholangiocarcinoma	DIS6GOC8	Strong	Biomarker	[18]
Liver cirrhosis	DIS4G1GX	Strong	Altered Expression	[2]
Small-cell lung cancer	DISK3LZD	Strong	Biomarker	[7]
Toxic epidermal necrolysis	DISIWPFR	Strong	Biomarker	[19]
Bacterial infection	DIS5QJ9S	moderate	Biomarker	[20]
Ductal breast carcinoma in situ	DISLCJY7	moderate	Altered Expression	[11]
Prostate cancer	DISF190Y	moderate	Altered Expression	[21]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Isotretinoin	DM4QTBN	Approved	Vigilin (HDLBP) increases the Lipids abnormal ADR of Isotretinoin.	[37]

5 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Vigilin (HDLBP).	[22]
Quercetin	DM3NC4M	Approved	Quercetin decreases the phosphorylation of Vigilin (HDLBP).	[28]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Vigilin (HDLBP).	[34]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Vigilin (HDLBP).	[28]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Vigilin (HDLBP).	[36]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Vigilin (HDLBP).	[23]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Vigilin (HDLBP).	[24]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Vigilin (HDLBP).	[25]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Vigilin (HDLBP).	[26]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Vigilin (HDLBP).	[27]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Vigilin (HDLBP).	[29]
Selenium	DM25CGV	Approved	Selenium increases the expression of Vigilin (HDLBP).	[30]
Zidovudine	DM4KI7O	Approved	Zidovudine decreases the expression of Vigilin (HDLBP).	[31]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of Vigilin (HDLBP).	[33]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Vigilin (HDLBP).	[35]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
DNCB	DMDTVYC	Phase 2	DNCB affects the binding of Vigilin (HDLBP).	[32]

References

• [1] Novel combined GPIHBP1 mutations in a patient with hypertriglyceridemia associated with CAD.J Atheroscler Thromb. 2013;20(10):777-84. doi: 10.5551/jat.18861. Epub 2013 Jul 8.
• [2] Vigilin is overexpressed in hepatocellular carcinoma and is required for HCC cell proliferation and tumor growth.Oncol Rep. 2014 May;31(5):2328-34. doi: 10.3892/or.2014.3111. Epub 2014 Mar 24.
• [3] Isolated high home systolic blood pressure in patients with type 2 diabetes is a prognostic factor for the development of diabetic nephropathy: KAMOGAWA-HBP study.Diabetes Res Clin Pract. 2019 Dec;158:107920. doi: 10.1016/j.diabres.2019.107920. Epub 2019 Nov 8.
• [4] Meta-analysis of genome-wide association studies discovers multiple loci for chronic lymphocytic leukemia.Nat Commun. 2016 Mar 9;7:10933. doi: 10.1038/ncomms10933.
• [5] FARP2, HDLBP and PASK are downregulated in a patient with autism and 2q37.3 deletion syndrome.Am J Med Genet A. 2009 May;149A(5):952-9. doi: 10.1002/ajmg.a.32779.
• [6] Escherichia coli hemoglobin protease autotransporter contributes to synergistic abscess formation and heme-dependent growth of Bacteroides fragilis.Infect Immun. 2002 Jan;70(1):5-10. doi: 10.1128/IAI.70.1.5-10.2002.
• [7] A new small cell lung cancer biomarker identified by Cell-SELEX generated aptamers.Exp Cell Res. 2019 Sep 15;382(2):111478. doi: 10.1016/j.yexcr.2019.06.023. Epub 2019 Jun 21.
• [8] The Healthy Brain Project: An Online Platform for the Recruitment, Assessment, and Monitoring of Middle-Aged Adults at Risk of Developing Alzheimer's Disease.J Alzheimers Dis. 2019;68(3):1211-1228. doi: 10.3233/JAD-181139.
• [9] High-density lipoprotein-binding protein (HBP)/vigilin is expressed in human atherosclerotic lesions and colocalizes with apolipoprotein E.Arterioscler Thromb Vasc Biol. 1997 Nov;17(11):2350-8. doi: 10.1161/01.atv.17.11.2350.
• [10] Accuracy of heparin binding protein: as a new marker in prediction of acute bacterial meningitis.Braz J Microbiol. 2018 Nov;49 Suppl 1(Suppl 1):213-219. doi: 10.1016/j.bjm.2018.05.007. Epub 2018 Aug 17.
• [11] Phenotype of vigilin expressing breast cancer cells binding to the 69 nt 3'UTR element in CSF-1R mRNA.Transl Oncol. 2019 Jan;12(1):106-115. doi: 10.1016/j.tranon.2018.09.012. Epub 2018 Oct 3.
• [12] A jack of all trades: the RNA-binding protein vigilin.Wiley Interdiscip Rev RNA. 2017 Nov;8(6). doi: 10.1002/wrna.1448. Epub 2017 Oct 4.
• [13] Home-based telerehabilitation in older patients with chronic obstructive pulmonary disease and heart failure: a randomised controlled trial.Age Ageing. 2018 Jan 1;47(1):82-88. doi: 10.1093/ageing/afx146.
• [14] Maximum morning home systolic blood pressure is an indicator of the development of diabetic nephropathy: The KAMOGAWA-HBP study.J Diabetes Investig. 2019 Nov;10(6):1543-1549. doi: 10.1111/jdi.13040. Epub 2019 May 7.
• [15] Iso- or hyperintensity of hepatocellular adenomas on hepatobiliary phase does not always correspond to hepatospecific contrast-agent uptake: importance for tumor subtyping.Eur Radiol. 2019 Jul;29(7):3791-3801. doi: 10.1007/s00330-019-06150-7. Epub 2019 Apr 1.
• [16] Follow-up of potential novel Graves' disease susceptibility loci, identified in the UK WTCCC genome-wide nonsynonymous SNP study.Eur J Hum Genet. 2010 Sep;18(9):1021-6. doi: 10.1038/ejhg.2010.55. Epub 2010 May 5.
• [17] LI-RADS v2014 categorization of hepatocellular carcinoma: Intraindividual comparison between gadopentetate dimeglumine-enhanced MRI and gadoxetic acid-enhanced MRI.Eur Radiol. 2019 Jan;29(1):401-410. doi: 10.1007/s00330-018-5559-z. Epub 2018 Jun 19.
• [18] Differentiation between inflammatory myofibroblastic tumor and cholangiocarcinoma manifesting as target appearance on gadoxetic acid-enhanced MRI.Abdom Radiol (NY). 2019 Apr;44(4):1395-1406. doi: 10.1007/s00261-018-1847-y.
• [19] Human somatic cell mutagenesis creates genetically tractable sarcomas.Nat Genet. 2014 Sep;46(9):964-72. doi: 10.1038/ng.3065. Epub 2014 Aug 17.
• [20] Heparin-binding protein: a key player in the pathophysiology of organ dysfunction in sepsis.J Intern Med. 2017 Jun;281(6):562-574. doi: 10.1111/joim.12604. Epub 2017 Mar 28.
• [21] O-GlcNAc transferase integrates metabolic pathways to regulate the stability of c-MYC in human prostate cancer cells.Cancer Res. 2013 Aug 15;73(16):5277-87. doi: 10.1158/0008-5472.CAN-13-0549. Epub 2013 May 29.
• [22] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [23] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [24] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [25] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [26] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [27] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [28] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [29] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [30] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [31] Morphological and molecular course of mitochondrial pathology in cultured human cells exposed long-term to Zidovudine. Environ Mol Mutagen. 2007 Apr-May;48(3-4):179-89. doi: 10.1002/em.20245.
• [32] Proteomic analysis of the cellular response to a potent sensitiser unveils the dynamics of haptenation in living cells. Toxicology. 2020 Dec 1;445:152603. doi: 10.1016/j.tox.2020.152603. Epub 2020 Sep 28.
• [33] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [34] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [35] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [36] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [37] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.