Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLG1P77)

DOT Name Cysteine dioxygenase type 1 (CDO1)
Synonyms EC 1.13.11.20; Cysteine dioxygenase type I; CDO; CDO-I
Gene Name CDO1
Related Disease
Benign prostatic hyperplasia ( )
Prostate cancer ( )
Prostate carcinoma ( )
Adenoma ( )
Adult glioblastoma ( )
Advanced cancer ( )
Barrett esophagus ( )
Biliary tract cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Cholangiocarcinoma ( )
Chronic hepatitis B virus infection ( )
Clear cell renal carcinoma ( )
Colon cancer ( )
Colon carcinoma ( )
Colorectal carcinoma ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Gallbladder cancer ( )
Gallbladder carcinoma ( )
Gallbladder disease ( )
Glioblastoma multiforme ( )
Hepatitis B virus infection ( )
Hepatocellular carcinoma ( )
Liver cirrhosis ( )
Matthew-Wood syndrome ( )
Mycosis fungoides ( )
Pancreatic cancer ( )
Sezary syndrome ( )
Squamous cell carcinoma ( )
Gastric cancer ( )
High blood pressure ( )
Leiomyosarcoma ( )
Lymphoma ( )
Non-insulin dependent diabetes ( )
Small intestine cancer ( )
Stomach cancer ( )
UniProt ID
CDO1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2IC1; 6BGF; 6BGM; 6BPR; 6BPS; 6BPT; 6BPU; 6BPV; 6BPW; 6BPX; 6CDH; 6CDN; 6E87; 6N42; 6N43
EC Number
1.13.11.20
Pfam ID
PF05995
Sequence
MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTR
NLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKK
SERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMT
FHSKFGIRTPNATSGSLENN
Function Catalyzes the oxidation of cysteine to cysteine sulfinic acid with addition of molecular dioxygen.
Tissue Specificity Highly expressed in liver and placenta. Low expression in heart, brain and pancreas. Also detected in hepatoblastoma Hep-G2 cells.
KEGG Pathway
Cysteine and methionine metabolism (hsa00270 )
Taurine and hypotaurine metabolism (hsa00430 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Degradation of cysteine and homocysteine (R-HSA-1614558 )
BioCyc Pathway
MetaCyc:HS05299-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

37 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Benign prostatic hyperplasia DISI3CW2 Definitive Biomarker [1]
Prostate cancer DISF190Y Definitive Posttranslational Modification [1]
Prostate carcinoma DISMJPLE Definitive Posttranslational Modification [1]
Adenoma DIS78ZEV Strong Posttranslational Modification [2]
Adult glioblastoma DISVP4LU Strong Biomarker [3]
Advanced cancer DISAT1Z9 Strong Posttranslational Modification [4]
Barrett esophagus DIS416Y7 Strong Posttranslational Modification [5]
Biliary tract cancer DISBNYQL Strong Posttranslational Modification [6]
Breast cancer DIS7DPX1 Strong Altered Expression [7]
Breast carcinoma DIS2UE88 Strong Altered Expression [7]
Cholangiocarcinoma DIS71F6X Strong Genetic Variation [8]
Chronic hepatitis B virus infection DISHL4NT Strong Posttranslational Modification [9]
Clear cell renal carcinoma DISBXRFJ Strong Posttranslational Modification [10]
Colon cancer DISVC52G Strong Biomarker [4]
Colon carcinoma DISJYKUO Strong Biomarker [4]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [4]
Endometrial cancer DISW0LMR Strong Posttranslational Modification [11]
Endometrial carcinoma DISXR5CY Strong Posttranslational Modification [11]
Gallbladder cancer DISXJUAF Strong Biomarker [12]
Gallbladder carcinoma DISD6ACL Strong Biomarker [12]
Gallbladder disease DISA6W3T Strong Posttranslational Modification [12]
Glioblastoma multiforme DISK8246 Strong Biomarker [3]
Hepatitis B virus infection DISLQ2XY Strong Posttranslational Modification [9]
Hepatocellular carcinoma DIS0J828 Strong Posttranslational Modification [9]
Liver cirrhosis DIS4G1GX Strong Posttranslational Modification [9]
Matthew-Wood syndrome DISA7HR7 Strong Posttranslational Modification [13]
Mycosis fungoides DIS62RB8 Strong Altered Expression [14]
Pancreatic cancer DISJC981 Strong Posttranslational Modification [13]
Sezary syndrome DISFMTC7 Strong Altered Expression [14]
Squamous cell carcinoma DISQVIFL Strong Posttranslational Modification [5]
Gastric cancer DISXGOUK Limited Posttranslational Modification [15]
High blood pressure DISY2OHH Limited Biomarker [16]
Leiomyosarcoma DIS6COXM Limited Posttranslational Modification [17]
Lymphoma DISN6V4S Limited Posttranslational Modification [17]
Non-insulin dependent diabetes DISK1O5Z Limited Biomarker [18]
Small intestine cancer DISVHFK0 Limited Posttranslational Modification [17]
Stomach cancer DISKIJSX Limited Posttranslational Modification [15]
------------------------------------------------------------------------------------
⏷ Show the Full List of 37 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Cysteine dioxygenase type 1 (CDO1). [19]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Cysteine dioxygenase type 1 (CDO1). [20]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Cysteine dioxygenase type 1 (CDO1). [21]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Cysteine dioxygenase type 1 (CDO1). [20]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Cysteine dioxygenase type 1 (CDO1). [22]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Cysteine dioxygenase type 1 (CDO1). [24]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Cysteine dioxygenase type 1 (CDO1). [26]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Cysteine dioxygenase type 1 (CDO1). [27]
OXYQUINOLINE DMZVS9Y Investigative OXYQUINOLINE decreases the expression of Cysteine dioxygenase type 1 (CDO1). [22]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Fulvestrant DM0YZC6 Approved Fulvestrant decreases the methylation of Cysteine dioxygenase type 1 (CDO1). [23]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Cysteine dioxygenase type 1 (CDO1). [25]
------------------------------------------------------------------------------------

References

1 CDO1 promoter methylation is associated with gene silencing and is a prognostic biomarker for biochemical recurrence-free survival in prostate cancer patients.Epigenetics. 2016 Dec;11(12):871-880. doi: 10.1080/15592294.2016.1241931. Epub 2016 Sep 30.
2 Cysteine dioxygenase type 1 (CDO1) gene promoter methylation during the adenoma-carcinoma sequence in colorectal cancer.PLoS One. 2018 May 10;13(5):e0194785. doi: 10.1371/journal.pone.0194785. eCollection 2018.
3 Cysteine catabolism: a novel metabolic pathway contributing to glioblastoma growth.Cancer Res. 2014 Feb 1;74(3):787-96. doi: 10.1158/0008-5472.CAN-13-1423. Epub 2013 Dec 18.
4 Epigenetic Status of CDO1 Gene May Reflect Chemosensitivity in Colon Cancer with Postoperative Adjuvant Chemotherapy.Ann Surg Oncol. 2019 Feb;26(2):406-414. doi: 10.1245/s10434-018-6865-z. Epub 2018 Oct 11.
5 The clinical significance of cysteine dioxygenase type 1 methylation in Barrett esophagus adenocarcinoma.Dis Esophagus. 2017 Mar 1;30(3):1-9. doi: 10.1093/dote/dow001.
6 Methylated promoter DNA of CDO1 gene and preoperative serum CA19-9 are prognostic biomarkers in primary extrahepatic cholangiocarcinoma.PLoS One. 2018 Oct 16;13(10):e0205864. doi: 10.1371/journal.pone.0205864. eCollection 2018.
7 Differential Prognostic Relevance of Promoter DNA Methylation of CDO1 and HOPX in Primary Breast Cancer.Anticancer Res. 2019 May;39(5):2289-2298. doi: 10.21873/anticanres.13345.
8 The novel colorectal cancer biomarkers CDO1, ZSCAN18 and ZNF331 are frequently methylated across gastrointestinal cancers.Int J Cancer. 2015 Feb 15;136(4):844-53. doi: 10.1002/ijc.29039. Epub 2014 Jun 28.
9 Methylated cysteine dioxygenase-1 gene promoter in the serum is a potential biomarker for hepatitis B virus-related hepatocellular carcinoma.Tohoku J Exp Med. 2014 Mar;232(3):187-94. doi: 10.1620/tjem.232.187.
10 Promoter Methylation of CDO1 Identifies Clear-Cell Renal Cell Cancer Patients with Poor Survival Outcome.Clin Cancer Res. 2015 Aug 1;21(15):3492-500. doi: 10.1158/1078-0432.CCR-14-2049. Epub 2015 Apr 22.
11 Combined genetic mutations and DNA-methylated genes as biomarkers for endometrial cancer detection from cervical scrapings.Clin Epigenetics. 2019 Nov 28;11(1):170. doi: 10.1186/s13148-019-0765-3.
12 Prognostic significance of promoter DNA hypermethylation of the cysteine dioxygenase 1 (CDO1) gene in primary gallbladder cancer and gallbladder disease.PLoS One. 2017 Nov 21;12(11):e0188178. doi: 10.1371/journal.pone.0188178. eCollection 2017.
13 Diagnostic potential of hypermethylation of the cysteine dioxygenase 1 gene (CDO1) promoter DNA in pancreatic cancer.Cancer Sci. 2019 Sep;110(9):2846-2855. doi: 10.1111/cas.14134. Epub 2019 Aug 10.
14 Szary syndrome is a unique cutaneous T-cell lymphoma as identified by an expanded gene signature including diagnostic marker molecules CDO1 and DNM3.Leukemia. 2008 Feb;22(2):393-9. doi: 10.1038/sj.leu.2405044. Epub 2007 Nov 22.
15 Cancer-specific promoter DNA methylation of Cysteine dioxygenase type 1 (CDO1) gene as an important prognostic biomarker of gastric cancer.PLoS One. 2019 Apr 1;14(4):e0214872. doi: 10.1371/journal.pone.0214872. eCollection 2019.
16 Alteration of cerebral taurine biosynthesis in spontaneously hypertensive rats.J Neurochem. 1984 Jun;42(6):1600-6. doi: 10.1111/j.1471-4159.1984.tb12748.x.
17 Clinical significance of cancer specific methylation of the CDO1 gene in small bowel cancer.PLoS One. 2019 Jan 24;14(1):e0211108. doi: 10.1371/journal.pone.0211108. eCollection 2019.
18 Alterations in hepatic metabolism of sulfur amino acids in non-obese type-2 diabetic Goto-Kakizaki rats.Chem Biol Interact. 2013 Jul 5;204(2):80-7. doi: 10.1016/j.cbi.2013.04.014. Epub 2013 May 9.
19 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
20 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
21 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
22 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
23 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
24 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
25 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
26 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
27 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.