Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLI3VA3)

DOT Name Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9)
Synonyms Complement C1q and tumor necrosis factor-related protein 9
Gene Name C1QTNF9
Related Disease
Arteriosclerosis ( )
Atherosclerosis ( )
Aortic valve stenosis ( )
Atrial fibrillation ( )
Cardiac disease ( )
Cardiac failure ( )
Cerebrovascular disease ( )
Congestive heart failure ( )
Coronary atherosclerosis ( )
Diabetic retinopathy ( )
Multiple sclerosis ( )
Non-alcoholic fatty liver disease ( )
Obesity ( )
Obstructive sleep apnea ( )
Vascular disease ( )
Cardiovascular disease ( )
Myocardial infarction ( )
Coronary heart disease ( )
Non-insulin dependent diabetes ( )
Type-1 diabetes ( )
UniProt ID
C1T9A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00386 ; PF01391
Sequence
MRIWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGR
PGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGP
QGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGI
RGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDMPIKFDKILYNEFNHYDTAAGK
FTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDE
VWLQVTGGERFNGLFADEDDDTTFTGFLLFSSP
Function Probable adipokine. Activates AMPK, AKT, and p44/42 MAPK signaling pathways.
Tissue Specificity Expressed predominantly in adipose tissue.

Molecular Interaction Atlas (MIA) of This DOT

20 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Arteriosclerosis DISK5QGC Definitive Altered Expression [1]
Atherosclerosis DISMN9J3 Definitive Altered Expression [1]
Aortic valve stenosis DISW7AQ9 Strong Biomarker [2]
Atrial fibrillation DIS15W6U Strong Altered Expression [3]
Cardiac disease DISVO1I5 Strong Altered Expression [2]
Cardiac failure DISDC067 Strong Biomarker [4]
Cerebrovascular disease DISAB237 Strong Biomarker [5]
Congestive heart failure DIS32MEA Strong Biomarker [4]
Coronary atherosclerosis DISKNDYU Strong Biomarker [6]
Diabetic retinopathy DISHGUJM Strong Biomarker [7]
Multiple sclerosis DISB2WZI Strong Altered Expression [8]
Non-alcoholic fatty liver disease DISDG1NL Strong Biomarker [9]
Obesity DIS47Y1K Strong Biomarker [9]
Obstructive sleep apnea DIS0SVD1 Strong Biomarker [10]
Vascular disease DISVS67S Strong Biomarker [11]
Cardiovascular disease DIS2IQDX moderate Biomarker [12]
Myocardial infarction DIS655KI Disputed Biomarker [10]
Coronary heart disease DIS5OIP1 Limited Biomarker [6]
Non-insulin dependent diabetes DISK1O5Z Limited Altered Expression [13]
Type-1 diabetes DIS7HLUB Limited Altered Expression [14]
------------------------------------------------------------------------------------
⏷ Show the Full List of 20 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9). [15]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9). [18]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9). [19]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9). [16]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Complement C1q and tumor necrosis factor-related protein 9A (C1QTNF9). [17]
------------------------------------------------------------------------------------

References

1 Overexpression of CTRP9 attenuates the development of atherosclerosis in apolipoprotein E-deficient mice.Mol Cell Biochem. 2019 May;455(1-2):99-108. doi: 10.1007/s11010-018-3473-y. Epub 2018 Nov 13.
2 C1q-TNF-Related Protein-9 Promotes Cardiac Hypertrophy and Failure.Circ Res. 2017 Jan 6;120(1):66-77. doi: 10.1161/CIRCRESAHA.116.309398. Epub 2016 Nov 7.
3 CTRP9 Ameliorates Atrial Inflammation, Fibrosis, and Vulnerability to Atrial Fibrillation in Post-Myocardial Infarction Rats.J Am Heart Assoc. 2019 Nov 5;8(21):e013133. doi: 10.1161/JAHA.119.013133. Epub 2019 Oct 18.
4 C1q/TNF-related protein 3 (CTRP3) and 9 (CTRP9) concentrations are decreased in patients with heart failure and are associated with increased morbidity and mortality.BMC Cardiovasc Disord. 2019 Jun 10;19(1):139. doi: 10.1186/s12872-019-1117-0.
5 Administration of rCTRP9 Attenuates Neuronal Apoptosis Through AdipoR1/PI3K/Akt Signaling Pathway after ICH in Mice.Cell Transplant. 2019 Jun;28(6):756-766. doi: 10.1177/0963689718822809. Epub 2019 Jan 14.
6 Autoantibodies Against (1)-Adrenoceptor Exaggerated Ventricular Remodeling by Inhibiting CTRP9 Expression.J Am Heart Assoc. 2019 Feb 19;8(4):e010475. doi: 10.1161/JAHA.118.010475.
7 C1q/TNF-related protein-9 attenuates retinal inflammation and protects blood-retinal barrier in db/db mice.Eur J Pharmacol. 2019 Jun 15;853:289-298. doi: 10.1016/j.ejphar.2019.04.012. Epub 2019 Apr 10.
8 Plasma levels of CTRP-3, CTRP-9 and apelin in women with multiple sclerosis.J Neuroimmunol. 2019 Aug 15;333:576968. doi: 10.1016/j.jneuroim.2019.576968. Epub 2019 May 16.
9 Serum C1q/TNF-related protein 9 is not related to nonalcoholic fatty liver disease.Cytokine. 2018 Oct;110:52-57. doi: 10.1016/j.cyto.2018.04.019. Epub 2018 Apr 25.
10 miRNA-Mediated Suppression of a Cardioprotective Cardiokine as a Novel Mechanism Exacerbating Post-MI Remodeling by Sleep Breathing Disorders.Circ Res. 2020 Jan 17;126(2):212-228. doi: 10.1161/CIRCRESAHA.119.315067. Epub 2019 Nov 7.
11 C1q/TNF-related protein 9: A novel therapeutic target in ischemic stroke?.J Neurosci Res. 2019 Feb;97(2):128-136. doi: 10.1002/jnr.24353. Epub 2018 Oct 31.
12 C1q tumor necrosis factor-related protein 9 in atherosclerosis: Mechanistic insights and therapeutic potential.Atherosclerosis. 2018 Sep;276:109-116. doi: 10.1016/j.atherosclerosis.2018.07.022. Epub 2018 Jul 19.
13 Association of circulating CTRP9 with soluble adhesion molecules and inflammatory markers in patients with type 2 diabetes mellitus and coronary artery disease.PLoS One. 2018 Jan 30;13(1):e0192159. doi: 10.1371/journal.pone.0192159. eCollection 2018.
14 CTRP9 Regulates Growth, Differentiation, and Apoptosis in Human Keratinocytes through TGF1-p38-Dependent Pathway.Mol Cells. 2017 Dec 31;40(12):906-915. doi: 10.14348/molcells.2017.0097. Epub 2017 Nov 16.
15 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
16 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
17 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
18 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
19 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.