Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMV4ASV)

• DOT Name: Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1)
• Synonyms: Atrophin-1-interacting protein 3; AIP-3; BAI1-associated protein 1; BAP-1; Membrane-associated guanylate kinase inverted 1; MAGI-1; Trinucleotide repeat-containing gene 19 protein; WW domain-containing protein 3; WWP3
• Gene Name: MAGI1
• Related Disease:
  Adenoma
  Adult T-cell leukemia/lymphoma
  Anxiety
  Arteriosclerosis
  Atherosclerosis
  Bipolar disorder
  Clear cell renal carcinoma
  Focal segmental glomerulosclerosis
  Hepatocellular carcinoma
  Inflammatory bowel disease
  Intrahepatic cholangiocarcinoma
  Lung cancer
  Lung carcinoma
  Mental disorder
  Narcolepsy
  Neoplasm
  Psoriatic arthritis
  Schizophrenia
  T-cell acute lymphoblastic leukaemia
  T-cell leukaemia
  Uveal Melanoma
  Adenovirus infection
  Crohn disease
  Metastatic malignant neoplasm
  Renal cell carcinoma
  Human T-lymphotropic virus 1 infectious disease
  Advanced cancer
  Cutaneous melanoma
  Knee osteoarthritis
  Melanoma
• UniProt ID: MAGI1_HUMAN
• PDB ID: 1WBP; 2KPK; 2KPL; 2Q9V; 2R4H; 2YSD; 2YSE; 2ZAJ; 3BPU; 5N7D; 5N7F; 5N7G; 6TWU; 6TWX; 6TWY; 7P71
• Pfam ID: PF00625 ; PF16663 ; PF16666 ; PF00595 ; PF00397
• Sequence:
  MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGE
  GPRLGEGELLLEVQGVRVSGLPRYDVLGVIDSCKEAVTFKAVRQGGRLNKDLRHFLNQRF
  QKGSPDHELQQTIRDNLYRHAVPCTTRSPREGEVPGVDYNFLTVKEFLDLEQSGTLLEVG
  TYEGNYYGTPKPPSQPVSGKVITTDALHSLQSGSKQSTPKRTKSYNDMQNAGIVHAENEE
  EDDVPEMNSSFTADSGEQEEHTLQETALPPVNSSIIAAPITDPSQKFPQYLPLSAEDNLG
  PLPENWEMAYTENGEVYFIDHNTKTTSWLDPRCLNKQQKPLEECEDDEGVHTEELDSELE
  LPAGWEKIEDPVYGIYYVDHINRKTQYENPVLEAKRKKQLEQQQQQQQQQQQQQQQQQQQ
  QTEEWTEDHSALVPPVIPNHPPSNPEPAREVPLQGKPFFTRNPSELKGKFIHTKLRKSSR
  GFGFTVVGGDEPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQ
  SIPIGASVDLELCRGYPLPFDPDDPNTSLVTSVAILDKEPIIVNGQETYDSPASHSSKTG
  KVNGMKDARPSSPADVASNSSHGYPNDTVSLASSIATQPELITVHIVKGPMGFGFTIADS
  PGGGGQRVKQIVDSPRCRGLKEGDLIVEVNKKNVQALTHNQVVDMLVECPKGSEVTLLVQ
  RGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEFPPAEAQAPDQ
  TDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQ
  DIFLWRKETGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELICVDGTPVIGKS
  HQLVVQLMQQAAKQGHVNLTVRRKVVFAVPKTENEVPSPASSHHSSNQPASLTEEKRTPQ
  GSQNSLNTVSSGSGSTSGIGSGGGGGSGVVSTVVQPYDVEIRRGENEGFGFVIVSSVSRP
  EAGTTFAGNACVAMPHKIGRIIEGSPADRCGKLKVGDRILAVNGCSITNKSHSDIVNLIK
  EAGNTVTLRIIPGDESSNATLLTNAEKIATITTTHTPSQQGTQETRNTTKPKQESQFEFK
  APQATQEQDFYTVELERGAKGFGFSLRGGREYNMDLYVLRLAEDGPAERCGKMRIGDEIL
  EINGETTKNMKHSRAIELIKNGGRRVRLFLKRGDGSVPEYDPSSDRHGPATGPQGVPEVR
  AGPDRRQHPSLESSYPPDLHKSSPHGEKRAHARDPKGSREYSRQPNEHHTWNGTSRKPDS
  GACRPKDRAPEGRRDAQAERAAAANGPKRRSPEKRREGTRSADNTLERREKHEKRRDVSP
  ERRRERSPTRRRDGSPSRRRRSLERLLEQRRSPERRRGGSPERRAKSTDRRRARSPERRR
  ERSLDKRNREDRASHREREEANLKQDAGRSSRHPPEQRRRPYKECSTDLSI
• Function: May play a role as scaffolding protein at cell-cell junctions. May regulate acid-induced ASIC3 currents by modulating its expression at the cell surface.
• Tissue Specificity: Widely expressed with the exception of skeletal muscle. Isoform 1, isoform 2 and isoform 6 are highly expressed in colon, kidney, lung, liver, and pancreas. Isoform 5 is predominantly expressed in brain and heart. Isoform 3 and isoform 4 are highly expressed in pancreas and brain.
• KEGG Pathway:
  Rap1 sig.ling pathway (hsa04015)
  PI3K-Akt sig.ling pathway (hsa04151)
  Tight junction (hsa04530)
  Human papillomavirus infection (hsa05165)

Molecular Interaction Atlas (MIA) of This DOT

30 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenoma	DIS78ZEV	Strong	Altered Expression	[1]
Adult T-cell leukemia/lymphoma	DIS882XU	Strong	Biomarker	[2]
Anxiety	DISIJDBA	Strong	Genetic Variation	[3]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[4]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[4]
Bipolar disorder	DISAM7J2	Strong	Biomarker	[5]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[6]
Focal segmental glomerulosclerosis	DISJNHH0	Strong	Genetic Variation	[7]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[8]
Inflammatory bowel disease	DISGN23E	Strong	Altered Expression	[4]
Intrahepatic cholangiocarcinoma	DIS6GOC8	Strong	Genetic Variation	[9]
Lung cancer	DISCM4YA	Strong	Genetic Variation	[9]
Lung carcinoma	DISTR26C	Strong	Genetic Variation	[9]
Mental disorder	DIS3J5R8	Strong	Biomarker	[10]
Narcolepsy	DISLCNLI	Strong	Genetic Variation	[11]
Neoplasm	DISZKGEW	Strong	Biomarker	[12]
Psoriatic arthritis	DISLWTG2	Strong	Genetic Variation	[13]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[14]
T-cell acute lymphoblastic leukaemia	DIS17AI2	Strong	Altered Expression	[2]
T-cell leukaemia	DISJ6YIF	Strong	Altered Expression	[2]
Uveal Melanoma	DISA7ZGL	Strong	Biomarker	[15]
Adenovirus infection	DISUYSBZ	moderate	Biomarker	[16]
Crohn disease	DIS2C5Q8	moderate	Genetic Variation	[17]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[18]
Renal cell carcinoma	DISQZ2X8	moderate	Biomarker	[6]
Human T-lymphotropic virus 1 infectious disease	DISN5C4M	Disputed	Altered Expression	[19]
Advanced cancer	DISAT1Z9	Limited	Genetic Variation	[20]
Cutaneous melanoma	DIS3MMH9	Limited	Genetic Variation	[20]
Knee osteoarthritis	DISLSNBJ	Limited	Genetic Variation	[21]
Melanoma	DIS1RRCY	Limited	Genetic Variation	[20]

7 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1).	[22]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the methylation of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1).	[23]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1).	[28]
Fulvestrant	DM0YZC6	Approved	Fulvestrant decreases the methylation of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1).	[31]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1).	[34]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1).	[36]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the methylation of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1).	[31]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1).	[24]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1).	[25]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1).	[26]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1).	[27]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1).	[29]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1).	[30]
Cytarabine	DMZD5QR	Approved	Cytarabine increases the expression of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1).	[32]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1).	[30]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1).	[33]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1).	[35]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1).	[37]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI1).	[38]

References

• [1] Regulation of aryl hydrocarbon receptor interacting protein (AIP) protein expression by MiR-34a in sporadic somatotropinomas.PLoS One. 2015 Feb 6;10(2):e0117107. doi: 10.1371/journal.pone.0117107. eCollection 2015.
• [2] MAGI-1 expression is decreased in several types of human T-cell leukemia cell lines, including adult T-cell leukemia.Int J Hematol. 2018 Mar;107(3):337-344. doi: 10.1007/s12185-017-2359-1. Epub 2017 Oct 17.
• [3] Meta-analysis of genome-wide association studies for neuroticism in 449,484 individuals identifies novel genetic loci and pathways.Nat Genet. 2018 Jul;50(7):920-927. doi: 10.1038/s41588-018-0151-7. Epub 2018 Jun 25.
• [4] MAGI1 as a link between endothelial activation and ER stress drives atherosclerosis.JCI Insight. 2019 Apr 4;4(7):e125570. doi: 10.1172/jci.insight.125570. eCollection 2019 Apr 4.
• [5] Investigating the genetic variation underlying episodicity in major depressive disorder: suggestive evidence for a bipolar contribution.J Affect Disord. 2014 Feb;155:81-9. doi: 10.1016/j.jad.2013.10.027. Epub 2013 Oct 29.
• [6] MAGI1 mediates tumor metastasis through c-Myb/miR-520h/MAGI1 signaling pathway in renal cell carcinoma.Apoptosis. 2019 Dec;24(11-12):837-848. doi: 10.1007/s10495-019-01562-8.
• [7] Up-regulation of the homophilic adhesion molecule sidekick-1 in podocytes contributes to glomerulosclerosis.J Biol Chem. 2010 Aug 13;285(33):25677-85. doi: 10.1074/jbc.M110.133959. Epub 2010 Jun 18.
• [8] Downregulation of MAGI1 associates with poor prognosis of hepatocellular carcinoma.J Invest Surg. 2012 Apr;25(2):93-9. doi: 10.3109/08941939.2011.606875. Epub 2011 Sep 26.
• [9] Prognostic role of BAP-1 and PBRM-1 expression in intrahepatic cholangiocarcinoma.Virchows Arch. 2019 Jan;474(1):29-37. doi: 10.1007/s00428-018-2478-y. Epub 2018 Oct 30.
• [10] Meta-analysis of Genome-wide Association Studies for Neuroticism, and the Polygenic Association With Major Depressive Disorder.JAMA Psychiatry. 2015 Jul;72(7):642-50. doi: 10.1001/jamapsychiatry.2015.0554.
• [11] Genome-wide association database developed in the Japanese Integrated Database Project.J Hum Genet. 2009 Sep;54(9):543-6. doi: 10.1038/jhg.2009.68. Epub 2009 Jul 24.
• [12] TTPAL Promotes Colorectal Tumorigenesis by Stabilizing TRIP6 to Activate Wnt/-Catenin Signaling.Cancer Res. 2019 Jul 1;79(13):3332-3346. doi: 10.1158/0008-5472.CAN-18-2986. Epub 2019 Apr 24.
• [13] A deletion at ADAMTS9-MAGI1 locus is associated with psoriatic arthritis risk.Ann Rheum Dis. 2015 Oct;74(10):1875-81. doi: 10.1136/annrheumdis-2014-207190. Epub 2015 May 19.
• [14] MAGI1 copy number variation in bipolar affective disorder and schizophrenia.Biol Psychiatry. 2012 May 15;71(10):922-30. doi: 10.1016/j.biopsych.2012.01.020. Epub 2012 Feb 28.
• [15] Density of PAS positive patterns in uveal melanoma: Correlation with vasculogenic mimicry, gene expression class, BAP-1 expression, macrophage infiltration, and risk for metastasis.Mol Vis. 2019 Sep 21;25:502-516. eCollection 2019.
• [16] The PDZ1 and PDZ3 domains of MAGI-1 regulate the eight-exon isoform of the coxsackievirus and adenovirus receptor.J Virol. 2012 Sep;86(17):9244-54. doi: 10.1128/JVI.01138-12. Epub 2012 Jun 20.
• [17] Identification of risk loci for Crohn's disease phenotypes using a genome-wide association study.Gastroenterology. 2015 Apr;148(4):794-805. doi: 10.1053/j.gastro.2014.12.030. Epub 2014 Dec 31.
• [18] Clinicopathological characteristics and molecular abnormalities of primary grade 2 neuroendocrine tumors of the cervix.Diagn Pathol. 2019 Jun 22;14(1):64. doi: 10.1186/s13000-019-0837-x.
• [19] Human T-cell leukemia virus type 1 Tax protein interacts with and mislocalizes the PDZ domain protein MAGI-1.Cancer Sci. 2013 Mar;104(3):313-20. doi: 10.1111/cas.12087. Epub 2013 Jan 30.
• [20] Giant Pediatric Rhabdoid Meningioma Associated with a Germline BAP1 Pathogenic Variation: A Rare Clinical Case.World Neurosurg. 2018 Nov;119:402-415. doi: 10.1016/j.wneu.2018.06.227. Epub 2018 Jul 6.
• [21] Genetic Determinants of Radiographic Knee Osteoarthritis in African Americans.J Rheumatol. 2017 Nov;44(11):1652-1658. doi: 10.3899/jrheum.161488. Epub 2017 Sep 15.
• [22] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [23] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [24] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [25] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [26] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [27] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [28] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [29] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [30] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [31] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [32] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [33] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [34] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [35] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [36] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [37] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [38] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.