Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTN6BR75)

DOT Name Dual specificity protein phosphatase 1 (DUSP1)
Synonyms EC 3.1.3.16; EC 3.1.3.48; Dual specificity protein phosphatase hVH1; Mitogen-activated protein kinase phosphatase 1; MAP kinase phosphatase 1; MKP-1; Protein-tyrosine phosphatase CL100
Gene Name DUSP1
UniProt ID
DUS1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
6APX; 6D65; 6D66; 6D67
EC Number
3.1.3.16; 3.1.3.48
Pfam ID
PF00782 ; PF00581
Sequence
MVMEVGTLDAGGLRALLGERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAM
GLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDGAKRDGTLALAAGALCREARAAQVFF
LKGGYEAFSASCPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPF
LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA
IDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS
FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSP
ITTSPSC
Function Dual specificity phosphatase that dephosphorylates MAP kinase MAPK1/ERK2 on both 'Thr-183' and 'Tyr-185', regulating its activity during the meiotic cell cycle.
Tissue Specificity Expressed at high levels in the lung, liver placenta and pancreas. Moderate levels seen in the heart and skeletal muscle. Lower levels found in the brain and kidney.
KEGG Pathway
MAPK sig.ling pathway (hsa04010 )
Serotonergic sy.pse (hsa04726 )
Parkinson disease (hsa05012 )
Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway
Negative regulation of MAPK pathway (R-HSA-5675221 )
RAF-independent MAPK1/3 activation (R-HSA-112409 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
65 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [1]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [5]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [6]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Dual specificity protein phosphatase 1 (DUSP1). [7]
Arsenic DMTL2Y1 Approved Arsenic increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [8]
Quercetin DM3NC4M Approved Quercetin increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [9]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Dual specificity protein phosphatase 1 (DUSP1). [10]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [11]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [12]
Testosterone DM7HUNW Approved Testosterone increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [12]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Dual specificity protein phosphatase 1 (DUSP1). [13]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [14]
Marinol DM70IK5 Approved Marinol decreases the expression of Dual specificity protein phosphatase 1 (DUSP1). [15]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Dual specificity protein phosphatase 1 (DUSP1). [16]
Progesterone DMUY35B Approved Progesterone increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [17]
Menadione DMSJDTY Approved Menadione affects the expression of Dual specificity protein phosphatase 1 (DUSP1). [18]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [19]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [20]
Azathioprine DMMZSXQ Approved Azathioprine increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [21]
Diclofenac DMPIHLS Approved Diclofenac affects the expression of Dual specificity protein phosphatase 1 (DUSP1). [13]
Piroxicam DMTK234 Approved Piroxicam decreases the expression of Dual specificity protein phosphatase 1 (DUSP1). [22]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [23]
Malathion DMXZ84M Approved Malathion decreases the expression of Dual specificity protein phosphatase 1 (DUSP1). [24]
Indomethacin DMSC4A7 Approved Indomethacin increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [25]
Azacitidine DMTA5OE Approved Azacitidine increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [26]
Thalidomide DM70BU5 Approved Thalidomide increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [27]
Hydrocortisone DMGEMB7 Approved Hydrocortisone increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [28]
Sertraline DM0FB1J Approved Sertraline increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [29]
Bexarotene DMOBIKY Approved Bexarotene decreases the expression of Dual specificity protein phosphatase 1 (DUSP1). [30]
Ampicillin DMHWE7P Approved Ampicillin increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [9]
Nitric Oxide DM1RBYG Approved Nitric Oxide increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [31]
Vandetanib DMRICNP Approved Vandetanib increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [32]
Fluticasone propionate DMRWLB2 Approved Fluticasone propionate increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [33]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [34]
Curcumin DMQPH29 Phase 3 Curcumin increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [35]
Chlorpromazine DMBGZI3 Phase 3 Trial Chlorpromazine increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [36]
Triptolide DMCMDVR Phase 3 Triptolide decreases the expression of Dual specificity protein phosphatase 1 (DUSP1). [37]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of Dual specificity protein phosphatase 1 (DUSP1). [38]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [39]
Phenol DM1QSM3 Phase 2/3 Phenol increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [40]
DNCB DMDTVYC Phase 2 DNCB increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [41]
Afimoxifene DMFORDT Phase 2 Afimoxifene increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [42]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [43]
Lithium DMZ3OU6 Phase 2 Lithium increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [44]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [45]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Dual specificity protein phosphatase 1 (DUSP1). [46]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [47]
Eugenol DM7US1H Patented Eugenol increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [23]
Torcetrapib DMDHYM7 Discontinued in Phase 2 Torcetrapib increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [48]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [49]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [51]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [52]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [53]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [54]
Paraquat DMR8O3X Investigative Paraquat increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [55]
Glyphosate DM0AFY7 Investigative Glyphosate affects the expression of Dual specificity protein phosphatase 1 (DUSP1). [56]
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [40]
D-glucose DMMG2TO Investigative D-glucose increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [57]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [58]
Resorcinol DMM37C0 Investigative Resorcinol increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [23]
cinnamaldehyde DMZDUXG Investigative cinnamaldehyde increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [23]
2-tert-butylbenzene-1,4-diol DMNXI1E Investigative 2-tert-butylbenzene-1,4-diol increases the expression of Dual specificity protein phosphatase 1 (DUSP1). [23]
------------------------------------------------------------------------------------
⏷ Show the Full List of 65 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Dual specificity protein phosphatase 1 (DUSP1). [50]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
4 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 p53 hypersensitivity is the predominant mechanism of the unique responsiveness of testicular germ cell tumor (TGCT) cells to cisplatin. PLoS One. 2011 Apr 21;6(4):e19198. doi: 10.1371/journal.pone.0019198.
7 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
8 Activation of inflammation/NF-kappaB signaling in infants born to arsenic-exposed mothers. PLoS Genet. 2007 Nov;3(11):e207.
9 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
10 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
11 Neuroprotective effects of glucomoringin-isothiocyanate against H(2)O(2)-Induced cytotoxicity in neuroblastoma (SH-SY5Y) cells. Neurotoxicology. 2019 Dec;75:89-104. doi: 10.1016/j.neuro.2019.09.008. Epub 2019 Sep 12.
12 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
13 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
14 Inflammation in methotrexate-induced pulmonary toxicity occurs via the p38 MAPK pathway. Toxicology. 2009 Feb 27;256(3):183-90. doi: 10.1016/j.tox.2008.11.016. Epub 2008 Nov 28.
15 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
16 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
17 Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
18 Time series analysis of oxidative stress response patterns in HepG2: a toxicogenomics approach. Toxicology. 2013 Apr 5;306:24-34.
19 Glucocorticoids inhibit cell death in ovarian cancer and up-regulate caspase inhibitor cIAP2. Clin Cancer Res. 2005 Sep 1;11(17):6325-32. doi: 10.1158/1078-0432.CCR-05-0182.
20 Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
21 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
22 Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
23 The THP-1 cell toolbox: a new concept integrating the key events of skin sensitization. Arch Toxicol. 2019 Apr;93(4):941-951.
24 Malathion induced cancer-linked gene expression in human lymphocytes. Environ Res. 2020 Mar;182:109131. doi: 10.1016/j.envres.2020.109131. Epub 2020 Jan 10.
25 Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
26 The effect of DNA methylation inhibitor 5-Aza-2'-deoxycytidine on human endometrial stromal cells. Hum Reprod. 2010 Nov;25(11):2859-69.
27 Polyunsaturated fatty acids synergize with lipid droplet binding thalidomide analogs to induce oxidative stress in cancer cells. Lipids Health Dis. 2010 Jun 2;9:56. doi: 10.1186/1476-511X-9-56.
28 Peripheral CLOCK regulates target-tissue glucocorticoid receptor transcriptional activity in a circadian fashion in man. PLoS One. 2011;6(9):e25612. doi: 10.1371/journal.pone.0025612. Epub 2011 Sep 28.
29 Sertraline induces endoplasmic reticulum stress in hepatic cells. Toxicology. 2014 Aug 1;322:78-88. doi: 10.1016/j.tox.2014.05.007. Epub 2014 May 24.
30 Identification of biomarkers modulated by the rexinoid LGD1069 (bexarotene) in human breast cells using oligonucleotide arrays. Cancer Res. 2006 Dec 15;66(24):12009-18.
31 Complex genetic response of human cells to sublethal levels of pure nitric oxide. Cancer Res. 1998 Aug 1;58(15):3435-40.
32 ZD6474 inhibits tumor growth and intraperitoneal dissemination in a highly metastatic orthotopic gastric cancer model. Int J Cancer. 2006 Jan 15;118(2):483-9. doi: 10.1002/ijc.21340.
33 Glucocorticoid receptor nuclear translocation in airway cells after inhaled combination therapy. Am J Respir Crit Care Med. 2005 Sep 15;172(6):704-12. doi: 10.1164/rccm.200408-1041OC. Epub 2005 Apr 28.
34 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
35 Gene expression profiling identifies activating transcription factor 3 as a novel contributor to the proapoptotic effect of curcumin. Mol Cancer Ther. 2005 Feb;4(2):233-41.
36 Effects of chlorpromazine with and without UV irradiation on gene expression of HepG2 cells. Mutat Res. 2005 Aug 4;575(1-2):47-60. doi: 10.1016/j.mrfmmm.2005.03.002. Epub 2005 Apr 26.
37 Differential expression and oxidation of MKP-1 modulates TNF-alpha gene expression. Am J Respir Cell Mol Biol. 2007 Sep;37(3):366-74. doi: 10.1165/rcmb.2006-0268OC. Epub 2007 May 16.
38 Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
39 Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
40 Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
41 MIP-1beta, a novel biomarker for in vitro sensitization test using human monocytic cell line. Toxicol In Vitro. 2006 Aug;20(5):736-42.
42 Estrogenic GPR30 signalling induces proliferation and migration of breast cancer cells through CTGF. EMBO J. 2009 Mar 4;28(5):523-32.
43 Depletion of the cellular levels of Bag-1 proteins attenuates phorbol ester-induced downregulation of IB and nuclear accumulation of NF-B. Biochem Biophys Res Commun. 2010 Oct 22;401(3):406-11. doi: 10.1016/j.bbrc.2010.09.067. Epub 2010 Sep 19.
44 A genetic network model of cellular responses to lithium treatment and cocaine abuse in bipolar disorder. BMC Syst Biol. 2010 Nov 19;4:158. doi: 10.1186/1752-0509-4-158.
45 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
46 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
47 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
48 Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
49 Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
50 Expression and DNA methylation changes in human breast epithelial cells after bisphenol A exposure. Int J Oncol. 2012 Jul;41(1):369-77.
51 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
52 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
53 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
54 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
55 Changes in differential gene expression in fibroblast cells from patients with triple A syndrome under oxidative stress. Horm Metab Res. 2013 Feb;45(2):102-8.
56 Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
57 Imbalance in the antioxidant defence system and pro-genotoxic status induced by high glucose concentrations: In vitro testing in human liver cells. Toxicol In Vitro. 2020 Dec;69:105001. doi: 10.1016/j.tiv.2020.105001. Epub 2020 Sep 15.
58 Altered gene expression patterns in MCF-7 cells induced by the urban dust particulate complex mixture standard reference material 1649a. Cancer Res. 2005 Feb 15;65(4):1251-8.