General Information of Drug Off-Target (DOT) (ID: OTPUZ5DE)

DOT Name CD99 antigen (CD99)
Synonyms 12E7; E2 antigen; Protein MIC2; T-cell surface glycoprotein E2; CD antigen CD99
Gene Name CD99
Related Disease
Acute lymphocytic leukaemia ( )
Adult glioblastoma ( )
Advanced cancer ( )
Astrocytoma ( )
Bone osteosarcoma ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Carcinoma ( )
Classic Hodgkin lymphoma ( )
Epithelial ovarian cancer ( )
Ewing sarcoma/peripheral primitive neuroectodermal tumor ( )
Gastric cancer ( )
Glioblastoma multiforme ( )
Glioma ( )
Hepatitis C virus infection ( )
Leukemia ( )
Lymphoma ( )
Malignant soft tissue neoplasm ( )
Myelodysplastic syndrome ( )
Neoplasm ( )
Neuroblastoma ( )
Non-small-cell lung cancer ( )
Osteosarcoma ( )
Ovarian cancer ( )
Primitive neuroectodermal tumor ( )
Prostate cancer ( )
Prostate carcinoma ( )
Sarcoma ( )
Stomach cancer ( )
Synovial sarcoma ( )
Toxoplasmosis ( )
X-linked retinoschisis ( )
Colon carcinoma ( )
leukaemia ( )
Adenocarcinoma ( )
Adult lymphoma ( )
B-cell neoplasm ( )
Chromosomal disorder ( )
Lung cancer ( )
Lung carcinoma ( )
Metastatic malignant neoplasm ( )
Pediatric lymphoma ( )
Plasma cell myeloma ( )
UniProt ID
CD99_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7SFX
Pfam ID
PF12301
Sequence
MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVV
DGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEE
ADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQR
TLLEK
Function
Involved in T-cell adhesion processes and in spontaneous rosette formation with erythrocytes. Plays a role in a late step of leukocyte extravasation helping leukocytes to overcome the endothelial basement membrane. Acts at the same site as, but independently of, PECAM1. Involved in T-cell adhesion processes.
KEGG Pathway
Cell adhesion molecules (hsa04514 )
Leukocyte transendothelial migration (hsa04670 )
Reactome Pathway
Cell surface interactions at the vascular wall (R-HSA-202733 )
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933 )

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute lymphocytic leukaemia DISPX75S Definitive Altered Expression [1]
Adult glioblastoma DISVP4LU Strong Altered Expression [2]
Advanced cancer DISAT1Z9 Strong Altered Expression [2]
Astrocytoma DISL3V18 Strong Altered Expression [2]
Bone osteosarcoma DIST1004 Strong Altered Expression [3]
Breast cancer DIS7DPX1 Strong Biomarker [4]
Breast carcinoma DIS2UE88 Strong Biomarker [4]
Breast neoplasm DISNGJLM Strong Altered Expression [4]
Carcinoma DISH9F1N Strong Biomarker [5]
Classic Hodgkin lymphoma DISV1LU6 Strong Biomarker [6]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [7]
Ewing sarcoma/peripheral primitive neuroectodermal tumor DISD4VQC Strong Biomarker [8]
Gastric cancer DISXGOUK Strong Biomarker [9]
Glioblastoma multiforme DISK8246 Strong Altered Expression [2]
Glioma DIS5RPEH Strong Biomarker [2]
Hepatitis C virus infection DISQ0M8R Strong Biomarker [10]
Leukemia DISNAKFL Strong Biomarker [11]
Lymphoma DISN6V4S Strong Altered Expression [12]
Malignant soft tissue neoplasm DISTC6NO Strong Altered Expression [13]
Myelodysplastic syndrome DISYHNUI Strong Biomarker [14]
Neoplasm DISZKGEW Strong Biomarker [3]
Neuroblastoma DISVZBI4 Strong Biomarker [15]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [16]
Osteosarcoma DISLQ7E2 Strong Altered Expression [3]
Ovarian cancer DISZJHAP Strong Biomarker [7]
Primitive neuroectodermal tumor DISFHXHA Strong Biomarker [17]
Prostate cancer DISF190Y Strong Altered Expression [18]
Prostate carcinoma DISMJPLE Strong Altered Expression [18]
Sarcoma DISZDG3U Strong Altered Expression [13]
Stomach cancer DISKIJSX Strong Biomarker [9]
Synovial sarcoma DISEZJS7 Strong Biomarker [5]
Toxoplasmosis DISYP8FH Strong Genetic Variation [19]
X-linked retinoschisis DISKV7Y8 Strong Altered Expression [6]
Colon carcinoma DISJYKUO moderate Biomarker [3]
leukaemia DISS7D1V moderate Biomarker [11]
Adenocarcinoma DIS3IHTY Limited Altered Expression [20]
Adult lymphoma DISK8IZR Limited Altered Expression [12]
B-cell neoplasm DISVY326 Limited Altered Expression [12]
Chromosomal disorder DISM5BB5 Limited Genetic Variation [21]
Lung cancer DISCM4YA Limited Genetic Variation [22]
Lung carcinoma DISTR26C Limited Genetic Variation [22]
Metastatic malignant neoplasm DIS86UK6 Limited Biomarker [23]
Pediatric lymphoma DIS51BK2 Limited Altered Expression [12]
Plasma cell myeloma DIS0DFZ0 Limited Altered Expression [24]
------------------------------------------------------------------------------------
⏷ Show the Full List of 44 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Methotrexate DM2TEOL Approved CD99 antigen (CD99) affects the response to substance of Methotrexate. [35]
------------------------------------------------------------------------------------
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of CD99 antigen (CD99). [25]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of CD99 antigen (CD99). [26]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of CD99 antigen (CD99). [27]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of CD99 antigen (CD99). [28]
Selenium DM25CGV Approved Selenium increases the expression of CD99 antigen (CD99). [29]
Cannabidiol DM0659E Approved Cannabidiol decreases the expression of CD99 antigen (CD99). [30]
Diphenylpyraline DMW4X37 Approved Diphenylpyraline increases the expression of CD99 antigen (CD99). [31]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of CD99 antigen (CD99). [29]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of CD99 antigen (CD99). [33]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of CD99 antigen (CD99). [34]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of CD99 antigen (CD99). [32]
------------------------------------------------------------------------------------

References

1 CD99 expression is strongly associated with clinical outcome in children with B-cell precursor acute lymphoblastic leukaemia.Br J Haematol. 2019 Feb;184(3):418-423. doi: 10.1111/bjh.15683. Epub 2018 Nov 28.
2 CD99 Expression in Glioblastoma Molecular Subtypes and Role in Migration and Invasion.Int J Mol Sci. 2019 Mar 6;20(5):1137. doi: 10.3390/ijms20051137.
3 Targeting Tumor Vascular CD99 Inhibits Tumor Growth.Front Immunol. 2019 Apr 2;10:651. doi: 10.3389/fimmu.2019.00651. eCollection 2019.
4 A splice variant of CD99 increases motility and MMP-9 expression of human breast cancer cells through the AKT-, ERK-, and JNK-dependent AP-1 activation signaling pathways.J Biol Chem. 2006 Nov 17;281(46):34833-47. doi: 10.1074/jbc.M605483200. Epub 2006 Sep 19.
5 Expression of TLE-1 and CD99 in Carcinoma: Pitfalls in Diagnosis of Synovial Sarcoma.Appl Immunohistochem Mol Morphol. 2018 Jul;26(6):368-373. doi: 10.1097/PAI.0000000000000436.
6 SEPTIN2 and STATHMIN Regulate CD99-Mediated Cellular Differentiation in Hodgkin's Lymphoma.PLoS One. 2015 May 22;10(5):e0127568. doi: 10.1371/journal.pone.0127568. eCollection 2015.
7 Nrf2 induced cisplatin resistance in ovarian cancer by promoting CD99 expression.Biochem Biophys Res Commun. 2019 Oct 22;518(4):698-705. doi: 10.1016/j.bbrc.2019.08.113. Epub 2019 Aug 28.
8 Primitive Neuroectodermal Tumors of the Female Genital Tract: A Morphologic, Immunohistochemical, and Molecular Study of 19 Cases.Am J Surg Pathol. 2017 Jun;41(6):761-772. doi: 10.1097/PAS.0000000000000831.
9 Immunoreactivity of CD99 in stomach cancer.J Korean Med Sci. 2002 Aug;17(4):483-9. doi: 10.3346/jkms.2002.17.4.483.
10 CS-SELEX generates high-affinity ssDNA aptamers as molecular probes for hepatitis C virus envelope glycoprotein E2.PLoS One. 2009 Dec 3;4(12):e8142. doi: 10.1371/journal.pone.0008142.
11 Clinical and preclinical characterization of CD99 isoforms in acute myeloid leukemia.Haematologica. 2020 Apr;105(4):999-1012. doi: 10.3324/haematol.2018.207001. Epub 2019 Aug 1.
12 p53 expression in large B-cell lymphomas with MYC extra copies and CD99 expression in large B-cell lymphomas in relation to MYC status.Hum Pathol. 2019 Apr;86:21-31. doi: 10.1016/j.humpath.2018.11.015. Epub 2018 Nov 26.
13 Histological and immunohistochemical characteristics of undifferentiated small round cell sarcomas associated with CIC-DUX4 and BCOR-CCNB3 fusion genes.Virchows Arch. 2017 Apr;470(4):373-380. doi: 10.1007/s00428-017-2072-8. Epub 2017 Feb 14.
14 Do preclinical studies suggest that CD99 is a potential therapeutic target in acute myeloid leukemia and the myelodysplastic syndromes?.Expert Opin Ther Targets. 2018 May;22(5):381-383. doi: 10.1080/14728222.2018.1464140. Epub 2018 Apr 20.
15 Adult neuroblastoma in the retroperitoneum: A case report.Medicine (Baltimore). 2018 Dec;97(51):e13750. doi: 10.1097/MD.0000000000013750.
16 CD99 is a novel prognostic stromal marker in non-small cell lung cancer.Int J Cancer. 2012 Nov 15;131(10):2264-73. doi: 10.1002/ijc.27518. Epub 2012 Apr 24.
17 Malignant glioma with primitive neuroectodermal tumor-like component (MG-PNET): novel microarray findings in a pediatric patient.Clin Neuropathol. 2016 Nov/Dec;35(6):353-367. doi: 10.5414/NP300942.
18 Androgen regulation of the human pseudoautosomal gene MIC2, a potential marker for prostate cancer.Mol Carcinog. 1998 Sep;23(1):13-9.
19 Toxoplasma gondii: DNA vaccination with genes encoding antigens MIC2, M2AP, AMA1 and BAG1 and evaluation of their immunogenic potential.Exp Parasitol. 2007 Jul;116(3):273-82. doi: 10.1016/j.exppara.2007.01.017. Epub 2007 Feb 1.
20 Clinical significance of CD99 down-regulation in gastric adenocarcinoma.Clin Cancer Res. 2007 May 1;13(9):2584-91. doi: 10.1158/1078-0432.CCR-06-1785.
21 Unusual myogenic and melanocytic differentiation of soft tissue pPNETs: an immunohistochemical and molecular study of 3 cases.Am J Surg Pathol. 2010 Jul;34(7):1002-6. doi: 10.1097/PAS.0b013e3181e03b81.
22 Cancer-associated mutations in the canonical cleavage site do not influence CD99 shedding by the metalloprotease meprin but alter cell migration in vitro.Oncotarget. 2017 Jul 4;8(33):54873-54888. doi: 10.18632/oncotarget.18966. eCollection 2017 Aug 15.
23 p53 and -Catenin Expression Predict Poorer Prognosis in Patients With Anaplastic Large-Cell Lymphoma.Clin Lymphoma Myeloma Leuk. 2019 Jul;19(7):e385-e392. doi: 10.1016/j.clml.2019.03.030. Epub 2019 Apr 5.
24 Tumor suppressor CD99 is downregulated in plasma cell neoplasms lacking CCND1 translocation and distinguishes neoplastic from normal plasma cells and B-cell lymphomas with plasmacytic differentiation from primary plasma cell neoplasms.Mod Pathol. 2018 Jun;31(6):881-889. doi: 10.1038/s41379-018-0011-0. Epub 2018 Feb 5.
25 The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
26 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
27 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
28 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
29 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
30 Cannabidiol Modulates the Immunophenotype and Inhibits the Activation of the Inflammasome in Human Gingival Mesenchymal Stem Cells. Front Physiol. 2016 Nov 24;7:559. doi: 10.3389/fphys.2016.00559. eCollection 2016.
31 Controlled diesel exhaust and allergen coexposure modulates microRNA and gene expression in humans: Effects on inflammatory lung markers. J Allergy Clin Immunol. 2016 Dec;138(6):1690-1700. doi: 10.1016/j.jaci.2016.02.038. Epub 2016 Apr 24.
32 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
33 Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
34 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
35 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.