Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQ1KVJO)

DOT Name Toll-like receptor 10 (TLR10)
Synonyms CD antigen CD290
Gene Name TLR10
Related Disease
Prostatitis ( )
Acute myocardial infarction ( )
Bladder cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Crohn disease ( )
Graves disease ( )
IgA nephropathy ( )
Influenza ( )
Juvenile idiopathic arthritis ( )
Marginal zone lymphoma ( )
Neoplasm ( )
Non-hodgkin lymphoma ( )
Non-insulin dependent diabetes ( )
Obesity ( )
Peripheral arterial disease ( )
Plasma cell myeloma ( )
Prostate cancer ( )
Prostate carcinoma ( )
Prostate neoplasm ( )
Rheumatoid arthritis ( )
Sarcoidosis ( )
Systemic sclerosis ( )
Transitional cell carcinoma ( )
Tuberculosis ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Urothelial carcinoma ( )
Uveitis ( )
Acute graft versus host disease ( )
Age-related macular degeneration ( )
Bacterial infection ( )
Colorectal carcinoma ( )
Gastric cancer ( )
Graft-versus-host disease ( )
Nasopharyngeal carcinoma ( )
Osteoarthritis ( )
Stomach cancer ( )
Hashimoto thyroiditis ( )
Keratoconjunctivitis sicca ( )
Meniere disease ( )
Thyroid gland papillary carcinoma ( )
UniProt ID
TLR10_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2J67
Pfam ID
PF13855 ; PF01582
Sequence
MRLIRNIYIFCSIVMTAEGDAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLL
FQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLR
YLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHY
EEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLE
NAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHFQIRNVTFGGKAYLDHNSFDYSNTVMR
TIKLEHVHFRVFYIQQDKIYLLLTKMDIENLTISNAQMPHMLFPNYPTKFQYLNFANNIL
TDELFKRTIQLPHLKTLILNGNKLETLSLVSCFANNTPLEHLDLSQNLLQHKNDENCSWP
ETVVNMNLSYNKLSDSVFRCLPKSIQILDLNNNQIQTVPKETIHLMALRELNIAFNFLTD
LPGCSHFSRLSVLNIEMNFILSPSLDFVQSCQEVKTLNAGRNPFRCTCELKNFIQLETYS
EVMMVGWSDSYTCEYPLNLRGTRLKDVHLHELSCNTALLIVTIVVIMLVLGLAVAFCCLH
FDLPWYLRMLGQCTQTWHRVRKTTQEQLKRNVRFHAFISYSEHDSLWVKNELIPNLEKED
GSILICLYESYFDPGKSISENIVSFIEKSYKSIFVLSPNFVQNEWCHYEFYFAHHNLFHE
NSDHIILILLEPIPFYCIPTRYHKLKALLEKKAYLEWPKDRRKCGLFWANLRAAINVNVL
ATREMYELQTFTELNEESRGSTISLMRTDCL
Function Participates in the innate immune response to microbial agents. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
Tissue Specificity Highly expressed in spleen, lymph node, thymus, tonsil and at lower levels in lung. Highly expressed in promyelocytic HL-60 cells and in B-cell lines.
Reactome Pathway
IRAK4 deficiency (TLR5) (R-HSA-5603037 )
MyD88 cascade initiated on plasma membrane (R-HSA-975871 )
Toll Like Receptor 10 (TLR10) Cascade (R-HSA-168142 )

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Prostatitis DISL8OGN Definitive Biomarker [1]
Acute myocardial infarction DISE3HTG Strong Altered Expression [2]
Bladder cancer DISUHNM0 Strong Genetic Variation [3]
Breast cancer DIS7DPX1 Strong Altered Expression [4]
Breast carcinoma DIS2UE88 Strong Altered Expression [4]
Crohn disease DIS2C5Q8 Strong Genetic Variation [5]
Graves disease DISU4KOQ Strong Genetic Variation [6]
IgA nephropathy DISZ8MTK Strong Genetic Variation [7]
Influenza DIS3PNU3 Strong Biomarker [8]
Juvenile idiopathic arthritis DISQZGBV Strong Genetic Variation [9]
Marginal zone lymphoma DISLZ4AO Strong Genetic Variation [10]
Neoplasm DISZKGEW Strong Genetic Variation [11]
Non-hodgkin lymphoma DISS2Y8A Strong Genetic Variation [10]
Non-insulin dependent diabetes DISK1O5Z Strong Altered Expression [12]
Obesity DIS47Y1K Strong Altered Expression [12]
Peripheral arterial disease DIS78WFB Strong Genetic Variation [13]
Plasma cell myeloma DIS0DFZ0 Strong Biomarker [14]
Prostate cancer DISF190Y Strong Genetic Variation [15]
Prostate carcinoma DISMJPLE Strong Genetic Variation [15]
Prostate neoplasm DISHDKGQ Strong Genetic Variation [15]
Rheumatoid arthritis DISTSB4J Strong Altered Expression [16]
Sarcoidosis DISE5B8Z Strong Genetic Variation [17]
Systemic sclerosis DISF44L6 Strong Altered Expression [18]
Transitional cell carcinoma DISWVVDR Strong Altered Expression [19]
Tuberculosis DIS2YIMD Strong Biomarker [20]
Urinary bladder cancer DISDV4T7 Strong Genetic Variation [3]
Urinary bladder neoplasm DIS7HACE Strong Genetic Variation [3]
Urothelial carcinoma DISRTNTN Strong Altered Expression [19]
Uveitis DISV0RYS Strong Genetic Variation [9]
Acute graft versus host disease DIS8KLVM moderate Genetic Variation [21]
Age-related macular degeneration DIS0XS2C moderate Altered Expression [22]
Bacterial infection DIS5QJ9S moderate Biomarker [23]
Colorectal carcinoma DIS5PYL0 moderate Genetic Variation [24]
Gastric cancer DISXGOUK moderate Genetic Variation [25]
Graft-versus-host disease DIS0QADF moderate Biomarker [21]
Nasopharyngeal carcinoma DISAOTQ0 moderate Genetic Variation [26]
Osteoarthritis DIS05URM moderate Genetic Variation [27]
Stomach cancer DISKIJSX moderate Genetic Variation [25]
Hashimoto thyroiditis DIS77CDF Limited Genetic Variation [28]
Keratoconjunctivitis sicca DISNOENH Limited Biomarker [29]
Meniere disease DISC5R5F Limited Genetic Variation [30]
Thyroid gland papillary carcinoma DIS48YMM Limited Genetic Variation [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 42 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic increases the expression of Toll-like receptor 10 (TLR10). [31]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Toll-like receptor 10 (TLR10). [32]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Toll-like receptor 10 (TLR10). [33]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Toll-like receptor 10 (TLR10). [34]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Toll-like receptor 10 (TLR10). [35]
------------------------------------------------------------------------------------

References

1 Toll-like receptor 10 (TLR10) exhibits suppressive effects on inflammation of prostate epithelial cells.Asian J Androl. 2019 Jul-Aug;21(4):393-399. doi: 10.4103/aja.aja_100_18.
2 Biomarkers identification for acute myocardial infarction detection via weighted gene co-expression network analysis.Medicine (Baltimore). 2017 Nov;96(47):e8375. doi: 10.1097/MD.0000000000008375.
3 Association between C13ORF31, NOD2, RIPK2 and TLR10 polymorphisms and urothelial bladder cancer.Hum Immunol. 2012 Jun;73(6):668-72. doi: 10.1016/j.humimm.2012.03.006. Epub 2012 Apr 12.
4 Reduced expression of Toll-like receptor 4 inhibits human breast cancer cells proliferation and inflammatory cytokines secretion.J Exp Clin Cancer Res. 2010 Jul 10;29(1):92. doi: 10.1186/1756-9966-29-92.
5 Genetic variation within TLR10 is associated with Crohn's disease in a New Zealand population.Hum Immunol. 2012 Apr;73(4):416-20. doi: 10.1016/j.humimm.2012.01.015. Epub 2012 Feb 2.
6 Polymorphisms in TLR1, TLR6 and TLR10 genes and the risk of Graves' disease.Autoimmunity. 2015 Feb;48(1):13-8. doi: 10.3109/08916934.2014.939269. Epub 2014 Jul 16.
7 Association between toll-like receptor 10 (TLR10) gene polymorphisms and childhood IgA nephropathy.Eur J Pediatr. 2011 Apr;170(4):503-9. doi: 10.1007/s00431-010-1325-1. Epub 2010 Oct 16.
8 Toll-like receptor 10 is involved in induction of innate immune responses to influenza virus infection.Proc Natl Acad Sci U S A. 2014 Mar 11;111(10):3793-8. doi: 10.1073/pnas.1324266111. Epub 2014 Feb 24.
9 Association of toll-like receptor 10 polymorphisms with paediatric idiopathic uveitis in Han Chinese.Br J Ophthalmol. 2020 Oct;104(10):1467-1471. doi: 10.1136/bjophthalmol-2019-314483. Epub 2019 Jul 4.
10 A pooled investigation of Toll-like receptor gene variants and risk of non-Hodgkin lymphoma.Carcinogenesis. 2009 Feb;30(2):275-81. doi: 10.1093/carcin/bgn262. Epub 2008 Nov 24.
11 A missense polymorphism (rs11466653, Met326Thr) of toll-like receptor 10 (TLR10) is associated with tumor size of papillary thyroid carcinoma in the Korean population.Endocrine. 2013 Feb;43(1):161-9. doi: 10.1007/s12020-012-9783-z. Epub 2012 Nov 3.
12 Increased Expression of the Innate Immune Receptor TLR10 in Obesity and Type-2 Diabetes: Association with ROS-Mediated Oxidative Stress.Cell Physiol Biochem. 2018;45(2):572-590. doi: 10.1159/000487034. Epub 2018 Jan 30.
13 Genetic Variants in the Bone Morphogenic Protein Gene Family Modify the Association between Residential Exposure to Traffic and Peripheral Arterial Disease.PLoS One. 2016 Apr 15;11(4):e0152670. doi: 10.1371/journal.pone.0152670. eCollection 2016.
14 Expression and function of toll-like receptors in multiple myeloma patients: toll-like receptor ligands promote multiple myeloma cell growth and survival via activation of nuclear factor-kappaB.Br J Haematol. 2010 Sep;150(5):543-53. doi: 10.1111/j.1365-2141.2010.08284.x. Epub 2010 Jul 14.
15 Genetic variation in the toll-like receptor gene cluster (TLR10-TLR1-TLR6) and prostate cancer risk.Int J Cancer. 2008 Dec 1;123(11):2644-50. doi: 10.1002/ijc.23826.
16 Erratum to "Increased Expression of TLR10 in B Cell Subsets Correlates with Disease Activity in Rheumatoid Arthritis".Mediators Inflamm. 2019 Mar 10;2019:8419439. doi: 10.1155/2019/8419439. eCollection 2019.
17 Genetic variation in the Toll-like receptor gene cluster (TLR10-TLR1-TLR6) influences disease course in sarcoidosis.Tissue Antigens. 2012 Jan;79(1):25-32. doi: 10.1111/j.1399-0039.2011.01808.x.
18 The expression profile of the toll-like receptor family in scleroderma dermal fibroblasts.Clin Exp Rheumatol. 2014 Nov-Dec;32(6 Suppl 86):S-4-9. Epub 2014 Jun 6.
19 Human TLR gene family members are differentially expressed in patients with urothelial carcinoma of the bladder.Urol Oncol. 2017 Dec;35(12):674.e11-674.e17. doi: 10.1016/j.urolonc.2017.07.029. Epub 2017 Aug 24.
20 Polymorphisms in Toll-Like Receptor 10 and Tuberculosis Susceptibility: Evidence from Three Independent Series.Front Immunol. 2018 Feb 23;9:309. doi: 10.3389/fimmu.2018.00309. eCollection 2018.
21 Toll-like receptor gene polymorphisms confer susceptibility to graft-versus-host disease in allogenic hematopoietic stem cell transplantation.Scand J Immunol. 2012 Sep;76(3):336-41. doi: 10.1111/j.1365-3083.2012.02737.x.
22 Increase in peripheral blood mononuclear cell Toll-like receptor 2/3 expression and reactivity to their ligands in a cohort of patients with wet age-related macular degeneration.Mol Vis. 2013 Aug 6;19:1826-33. eCollection 2013.
23 Genetic polymorphisms in TLR1, TLR2, TLR4, and TLR10 of Helicobacter pylori-associated gastritis: a prospective cross-sectional study in Thailand.Eur J Cancer Prev. 2018 Mar;27(2):118-123. doi: 10.1097/CEJ.0000000000000347.
24 Meat and fiber intake and interaction with pattern recognition receptors (TLR1, TLR2, TLR4, and TLR10) in relation to colorectal cancer in a Danish prospective, case-cohort study.Am J Clin Nutr. 2018 Mar 1;107(3):465-479. doi: 10.1093/ajcn/nqx011.
25 Polymorphisms at Locus 4p14 of Toll-Like Receptors TLR-1 and TLR-10 Confer Susceptibility to Gastric Carcinoma in Helicobacter pylori Infection.PLoS One. 2015 Nov 11;10(11):e0141865. doi: 10.1371/journal.pone.0141865. eCollection 2015.
26 Sequence variants in toll-like receptor 10 are associated with nasopharyngeal carcinoma risk.Cancer Epidemiol Biomarkers Prev. 2006 May;15(5):862-6. doi: 10.1158/1055-9965.EPI-05-0874.
27 Interleukin-17 and Toll-like Receptor 10 genetic polymorphisms and susceptibility to large joint osteoarthritis.J Orthop Res. 2018 Jun;36(6):1684-1693. doi: 10.1002/jor.23823. Epub 2017 Dec 19.
28 IRAK2 and TLR10 confer risk of Hashimoto's disease: a genetic association study based on the Han Chinese population.J Hum Genet. 2019 Jul;64(7):617-623. doi: 10.1038/s10038-019-0613-5. Epub 2019 May 9.
29 Increased expression of hepcidin and toll-like receptors 8 and 10 in viral keratitis.Cornea. 2011 Aug;30(8):899-904. doi: 10.1097/ICO.0b013e31820126e5.
30 Allelic variants in TLR10 gene may influence bilateral affectation and clinical course of Meniere's disease.Immunogenetics. 2013 May;65(5):345-55. doi: 10.1007/s00251-013-0683-z. Epub 2013 Feb 1.
31 Transcriptomics and methylomics of CD4-positive T cells in arsenic-exposed women. Arch Toxicol. 2017 May;91(5):2067-2078. doi: 10.1007/s00204-016-1879-4. Epub 2016 Nov 12.
32 Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
33 Discovery and characterization of super-enhancer-associated dependencies in diffuse large B cell lymphoma. Cancer Cell. 2013 Dec 9;24(6):777-90. doi: 10.1016/j.ccr.2013.11.003.
34 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
35 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.