Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRWZJ68)

DOT Name Ropporin-1-like protein (ROPN1L)
Synonyms ROPN1-like protein; AKAP-associated sperm protein
Gene Name ROPN1L
Related Disease
Malaria ( )
Alzheimer disease ( )
Amyotrophic lateral sclerosis ( )
Ankylosing spondylitis ( )
Central diabetes insipidus ( )
Colorectal carcinoma ( )
Depression ( )
Esophageal adenocarcinoma ( )
Fibrodysplasia ossificans progressiva ( )
leukaemia ( )
Leukemia ( )
Major depressive disorder ( )
Malignant mesothelioma ( )
Metastatic malignant neoplasm ( )
Mitochondrial disease ( )
Myocardial infarction ( )
Myocardial ischemia ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Obesity ( )
Osteoarthritis ( )
Pancreatitis ( )
Polyp ( )
Premature aging syndrome ( )
Psoriatic arthritis ( )
Schizophrenia ( )
Advanced cancer ( )
Lymphoid leukemia ( )
Rheumatoid arthritis ( )
Breast cancer ( )
Breast carcinoma ( )
UniProt ID
ROP1L_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
8J07
Sequence
MPLPDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLRWSAGYFSALSRGDPLPVKDR
MEMPTATQKTDTGLTQGLLKVLHKQCHHKRYVELTDLEQKWKNLCLPKEKFKALLQLDPC
ENKIKWINFLALGCSMLGGSLNTALKHLCEILTDDPEGGPARIPFKTFSYVYRYLARLDS
DVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDVGH
Function
Functions as part of axonemal radial spoke complexes that play an important part in the motility of sperm and cilia. Important for male fertility. With ROPN1, involved in fibrous sheath integrity and sperm motility, plays a role in PKA-dependent signaling processes required for spermatozoa capacitation.

Molecular Interaction Atlas (MIA) of This DOT

31 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Malaria DISQ9Y50 Definitive Genetic Variation [1]
Alzheimer disease DISF8S70 Strong Biomarker [2]
Amyotrophic lateral sclerosis DISF7HVM Strong Biomarker [3]
Ankylosing spondylitis DISRC6IR Strong Genetic Variation [4]
Central diabetes insipidus DISJ4P9O Strong Biomarker [5]
Colorectal carcinoma DIS5PYL0 Strong Genetic Variation [6]
Depression DIS3XJ69 Strong Biomarker [7]
Esophageal adenocarcinoma DISODWFP Strong Altered Expression [8]
Fibrodysplasia ossificans progressiva DISAT6WU Strong Biomarker [9]
leukaemia DISS7D1V Strong Biomarker [10]
Leukemia DISNAKFL Strong Biomarker [10]
Major depressive disorder DIS4CL3X Strong Biomarker [7]
Malignant mesothelioma DISTHJGH Strong Biomarker [11]
Metastatic malignant neoplasm DIS86UK6 Strong Genetic Variation [12]
Mitochondrial disease DISKAHA3 Strong Genetic Variation [13]
Myocardial infarction DIS655KI Strong Biomarker [14]
Myocardial ischemia DISFTVXF Strong Biomarker [14]
Neoplasm DISZKGEW Strong Biomarker [15]
Non-small-cell lung cancer DIS5Y6R9 Strong Genetic Variation [16]
Obesity DIS47Y1K Strong Altered Expression [17]
Osteoarthritis DIS05URM Strong Altered Expression [18]
Pancreatitis DIS0IJEF Strong Biomarker [19]
Polyp DISRSLYF Strong Biomarker [20]
Premature aging syndrome DIS51AGT Strong Genetic Variation [21]
Psoriatic arthritis DISLWTG2 Strong Biomarker [4]
Schizophrenia DISSRV2N Strong Biomarker [22]
Advanced cancer DISAT1Z9 Disputed Biomarker [23]
Lymphoid leukemia DIS65TYQ Disputed Biomarker [24]
Rheumatoid arthritis DISTSB4J Disputed Biomarker [4]
Breast cancer DIS7DPX1 Limited Genetic Variation [25]
Breast carcinoma DIS2UE88 Limited Genetic Variation [25]
------------------------------------------------------------------------------------
⏷ Show the Full List of 31 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Ropporin-1-like protein (ROPN1L). [26]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Ropporin-1-like protein (ROPN1L). [27]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Ropporin-1-like protein (ROPN1L). [28]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Ropporin-1-like protein (ROPN1L). [29]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Ropporin-1-like protein (ROPN1L). [30]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Ropporin-1-like protein (ROPN1L). [31]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of Ropporin-1-like protein (ROPN1L). [33]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Ropporin-1-like protein (ROPN1L). [32]
------------------------------------------------------------------------------------

References

1 Genotyping of the Duffy blood group among Plasmodium knowlesi-infected patients in Malaysia.PLoS One. 2014 Sep 30;9(9):e108951. doi: 10.1371/journal.pone.0108951. eCollection 2014.
2 Metabolite Profile of Alzheimer's Disease in the Frontal Cortex as Analyzed by HRMAS (1)H NMR.Front Aging Neurosci. 2019 Jan 9;10:424. doi: 10.3389/fnagi.2018.00424. eCollection 2018.
3 In vitro activation of GAT1 transporters expressed in spinal cord gliosomes stimulates glutamate release that is abnormally elevated in the SOD1/G93A(+) mouse model of amyotrophic lateral sclerosis.J Neurochem. 2010 Apr;113(2):489-501. doi: 10.1111/j.1471-4159.2010.06628.x. Epub 2010 Feb 1.
4 High rates of tuberculin skin test positivity due to methotrexate therapy: False positive results?.Semin Arthritis Rheum. 2018 Dec;48(3):538-546. doi: 10.1016/j.semarthrit.2018.03.018. Epub 2018 Mar 29.
5 Diagnostic stewardship of C. difficile testing: a quasi-experimental antimicrobial stewardship study.Infect Control Hosp Epidemiol. 2019 Mar;40(3):269-275. doi: 10.1017/ice.2018.336. Epub 2019 Feb 21.
6 KRAS mutations in non-small-cell lung cancer and colorectal cancer: implications for EGFR-targeted therapies.Lung Cancer. 2014 Feb;83(2):163-7. doi: 10.1016/j.lungcan.2013.11.010. Epub 2013 Nov 21.
7 Aversive startle potentiation and fear pathology: Mediating role of threat sensitivity and moderating impact of depression.Int J Psychophysiol. 2015 Nov;98(2 Pt 2):262-269. doi: 10.1016/j.ijpsycho.2014.10.014. Epub 2014 Nov 6.
8 Multiple forms of genetic instability within a 2-Mb chromosomal segment of 3q26.3-q27 are associated with development of esophageal adenocarcinoma.Genes Chromosomes Cancer. 2006 Apr;45(4):319-31. doi: 10.1002/gcc.20293.
9 Restoration of normal BMP signaling levels and osteogenic differentiation in FOP mesenchymal progenitor cells by mutant allele-specific targeting.Gene Ther. 2012 Jul;19(7):786-90. doi: 10.1038/gt.2011.152. Epub 2011 Oct 20.
10 Growth inhibitory and proapoptotic effects of l-asparaginase from Fusarium culmorum ASP-87 on human leukemia cells (Jurkat).Fundam Clin Pharmacol. 2017 Jun;31(3):292-300. doi: 10.1111/fcp.12257. Epub 2016 Dec 30.
11 Can novel adipokines, asprosin and meteorin-like, be biomarkers for malignant mesothelioma?.Biotech Histochem. 2020 Apr;95(3):171-175. doi: 10.1080/10520295.2019.1656344. Epub 2019 Oct 1.
12 Sensitive methods for detection of the S768R substitution in exon 18 of the DDR2 gene in patients with central nervous system metastases of non-small cell lung cancer.Med Oncol. 2014 Oct;31(10):176. doi: 10.1007/s12032-014-0176-4. Epub 2014 Aug 31.
13 A novel m.7539C>T point mutation in the mt-tRNA(Asp) gene associated with multisystemic mitochondrial disease.Neuromuscul Disord. 2015 Jan;25(1):81-4. doi: 10.1016/j.nmd.2014.09.008. Epub 2014 Sep 28.
14 Asprosin improves the survival of mesenchymal stromal cells in myocardial infarction by inhibiting apoptosis via the activated ERK1/2-SOD2 pathway.Life Sci. 2019 Aug 15;231:116554. doi: 10.1016/j.lfs.2019.116554. Epub 2019 Jun 10.
15 Clinical impact of aspartyl aminopeptidase expression and activity in colorectal cancer.Transl Res. 2013 Nov;162(5):297-308. doi: 10.1016/j.trsl.2013.07.010. Epub 2013 Aug 13.
16 Sensitive methods for screening of the MEK1 gene mutations in patients with central nervous system metastases of non-small cell lung cancer.Clin Transl Oncol. 2016 Oct;18(10):1039-43. doi: 10.1007/s12094-016-1483-3. Epub 2016 Feb 9.
17 The mouse mahoganoid coat color mutation disrupts a novel C3HC4 RING domain protein.J Clin Invest. 2002 Nov;110(10):1449-59. doi: 10.1172/JCI16131.
18 Angelica Sinensis polysaccharides stimulated UDP-sugar synthase genes through promoting gene expression of IGF-1 and IGF1R in chondrocytes: promoting anti-osteoarthritic activity.PLoS One. 2014 Sep 9;9(9):e107024. doi: 10.1371/journal.pone.0107024. eCollection 2014.
19 Severe drug-induced hypertriglyceridemia treated with plasmapheresis in children with acute lymphoblastic leukemia.Transfus Apher Sci. 2019 Oct;58(5):634-637. doi: 10.1016/j.transci.2019.08.025. Epub 2019 Sep 5.
20 Differential expression of organic cation transporters in normal and polyps human nasal epithelium: implications for in vitro drug delivery studies.Int J Pharm. 2011 Mar 15;406(1-2):49-54. doi: 10.1016/j.ijpharm.2010.12.037. Epub 2011 Jan 8.
21 Accumulation of deletions and point mutations in mitochondrial genome in degenerative diseases.Ann N Y Acad Sci. 1996 Jun 15;786:102-11. doi: 10.1111/j.1749-6632.1996.tb39055.x.
22 C3 Polymorphism Influences Circulating Levels of C3, ASP and Lipids in Schizophrenic Patients.Neurochem Res. 2015 May;40(5):906-14. doi: 10.1007/s11064-015-1543-z. Epub 2015 Feb 27.
23 AS1041, a Novel Synthesized Derivative of Marine Natural Compound Aspergiolide A, Arrests Cell Cycle, Induces Apoptosis, and Inhibits ERK Activation in K562 Cells.Mar Drugs. 2017 Nov 4;15(11):346. doi: 10.3390/md15110346.
24 Interaction between Gallic acid and Asparaginase to potentiate anti-proliferative effect on lymphoblastic leukemia cell line.Biomed Pharmacother. 2017 Dec;96:1045-1054. doi: 10.1016/j.biopha.2017.11.122. Epub 2017 Dec 6.
25 ErbB4 receptor polymorphism 2368A>C and risk of breast cancer.Breast. 2018 Dec;42:157-163. doi: 10.1016/j.breast.2018.10.002. Epub 2018 Oct 9.
26 Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
27 Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
28 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
29 The molecular basis of genistein-induced mitotic arrest and exit of self-renewal in embryonal carcinoma and primary cancer cell lines. BMC Med Genomics. 2008 Oct 10;1:49.
30 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
31 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
32 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
33 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.