Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTU74TB8)

DOT Name Homeobox protein Hox-B5 (HOXB5)
Synonyms Homeobox protein HHO.C10; Homeobox protein Hox-2A; Homeobox protein Hu-1
Gene Name HOXB5
Related Disease
Hirschsprung disease ( )
Acute lymphocytic leukaemia ( )
Adult glioblastoma ( )
Bladder cancer ( )
Campomelic dysplasia ( )
Carcinoma ( )
Cardiovascular disease ( )
Estrogen-receptor positive breast cancer ( )
Gastric cancer ( )
Glioblastoma multiforme ( )
leukaemia ( )
Leukemia ( )
Neuroblastoma ( )
Obesity ( )
Oral cancer ( )
Renal carcinoma ( )
Renal cell carcinoma ( )
Retinoblastoma ( )
Squamous cell carcinoma ( )
Stomach cancer ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Neoplasm ( )
Acute myelogenous leukaemia ( )
Breast cancer ( )
Breast carcinoma ( )
Non-small-cell lung cancer ( )
UniProt ID
HXB5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00046
Sequence
MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYNGMDLSVNRSS
ASSSHFGAVGESSRAFPAPAQEPRFRQAASSCSLSSPESLPCTNGDSHGAKPSASSPSDQ
ATSASSSANFTEIDEASASSEPEEAASQLSSPSLARAQPEPMATSTAAPEGQTPQIFPWM
RKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKI
WFQNRRMKWKKDNKLKSMSLATAGSAFQP
Function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Tissue Specificity Spinal cord.

Molecular Interaction Atlas (MIA) of This DOT

27 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Hirschsprung disease DISUUSM1 Definitive Biomarker [1]
Acute lymphocytic leukaemia DISPX75S Strong Biomarker [2]
Adult glioblastoma DISVP4LU Strong Genetic Variation [3]
Bladder cancer DISUHNM0 Strong Biomarker [4]
Campomelic dysplasia DISVTW53 Strong Biomarker [5]
Carcinoma DISH9F1N Strong Biomarker [6]
Cardiovascular disease DIS2IQDX Strong Genetic Variation [7]
Estrogen-receptor positive breast cancer DIS1H502 Strong Altered Expression [8]
Gastric cancer DISXGOUK Strong Biomarker [9]
Glioblastoma multiforme DISK8246 Strong Genetic Variation [3]
leukaemia DISS7D1V Strong Altered Expression [2]
Leukemia DISNAKFL Strong Altered Expression [2]
Neuroblastoma DISVZBI4 Strong Altered Expression [1]
Obesity DIS47Y1K Strong Genetic Variation [10]
Oral cancer DISLD42D Strong Biomarker [6]
Renal carcinoma DISER9XT Strong Genetic Variation [11]
Renal cell carcinoma DISQZ2X8 Strong Genetic Variation [11]
Retinoblastoma DISVPNPB Strong Biomarker [12]
Squamous cell carcinoma DISQVIFL Strong Altered Expression [6]
Stomach cancer DISKIJSX Strong Biomarker [9]
Urinary bladder cancer DISDV4T7 Strong Biomarker [4]
Urinary bladder neoplasm DIS7HACE Strong Biomarker [4]
Neoplasm DISZKGEW moderate Biomarker [13]
Acute myelogenous leukaemia DISCSPTN Limited Altered Expression [14]
Breast cancer DIS7DPX1 Limited Altered Expression [15]
Breast carcinoma DIS2UE88 Limited Altered Expression [15]
Non-small-cell lung cancer DIS5Y6R9 Limited Biomarker [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 27 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of Homeobox protein Hox-B5 (HOXB5). [16]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Homeobox protein Hox-B5 (HOXB5). [17]
Triclosan DMZUR4N Approved Triclosan increases the expression of Homeobox protein Hox-B5 (HOXB5). [19]
Permethrin DMZ0Q1G Approved Permethrin increases the expression of Homeobox protein Hox-B5 (HOXB5). [20]
Curcumin DMQPH29 Phase 3 Curcumin increases the expression of Homeobox protein Hox-B5 (HOXB5). [21]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Homeobox protein Hox-B5 (HOXB5). [22]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN decreases the expression of Homeobox protein Hox-B5 (HOXB5). [23]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Homeobox protein Hox-B5 (HOXB5). [24]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic increases the methylation of Homeobox protein Hox-B5 (HOXB5). [18]
------------------------------------------------------------------------------------

References

1 HOXB5 binds to multi-species conserved sequence (MCS+9.7) of RET gene and regulates RET expression.Int J Biochem Cell Biol. 2014 Jun;51:142-9. doi: 10.1016/j.biocel.2014.04.013. Epub 2014 Apr 29.
2 Expression of selected human HOX-2 genes in B/T acute lymphoid leukemia and interleukin-2/interleukin-1 beta-stimulated natural killer lymphocytes.Blood. 1992 Jul 1;80(1):185-93.
3 Modulation of HOX2 gene expression following differentiation of neuronal cell lines.Differentiation. 1992 Sep;51(1):39-47. doi: 10.1111/j.1432-0436.1992.tb00678.x.
4 Integrated analysis of a competing endogenous RNA network reveals key lncRNAs as potential prognostic biomarkers for human bladder cancer.Medicine (Baltimore). 2018 Aug;97(35):e11887. doi: 10.1097/MD.0000000000011887.
5 Assignment of an autosomal sex reversal locus (SRA1) and campomelic dysplasia (CMPD1) to 17q24.3-q25.1.Nat Genet. 1993 Jun;4(2):170-4. doi: 10.1038/ng0693-170.
6 HOXB5 expression in oral squamous cell carcinoma.J Appl Oral Sci. 2011 Apr;19(2):125-9. doi: 10.1590/s1678-77572011000200008.
7 Leveraging Polygenic Functional Enrichment to Improve GWAS Power.Am J Hum Genet. 2019 Jan 3;104(1):65-75. doi: 10.1016/j.ajhg.2018.11.008. Epub 2018 Dec 27.
8 HOXB5 Promotes the Proliferation and Invasion of Breast Cancer Cells.Int J Biol Sci. 2015 May 1;11(6):701-11. doi: 10.7150/ijbs.11431. eCollection 2015.
9 HOXB5 induces invasion and migration through direct transcriptional up-regulation of -catenin in human gastric carcinoma.Biochem J. 2015 Dec 15;472(3):393-403. doi: 10.1042/BJ20150213. Epub 2015 Oct 14.
10 Association study of common polymorphisms in MSRA, TFAP2B, MC4R, NRXN3, PPARGC1A, TMEM18, SEC16B, HOXB5 and OLFM4 genes with obesity-related traits among Portuguese children.J Hum Genet. 2014 Jun;59(6):307-13. doi: 10.1038/jhg.2014.23. Epub 2014 Mar 27.
11 HOX gene expression in normal and neoplastic human kidney.Int J Cancer. 1992 Jul 30;51(6):892-7. doi: 10.1002/ijc.2910510610.
12 HOXB5 promotes retinoblastoma cell migration and invasion via ERK1/2 pathway-mediated MMPs production.Am J Transl Res. 2018 Jun 15;10(6):1703-1712. eCollection 2018.
13 MicroRNA-625 inhibits the progression of nonsmall cell lung cancer by directly targeting HOXB5 and deactivating the Wnt/-catenin pathway.Int J Mol Med. 2019 Jul;44(1):346-356. doi: 10.3892/ijmm.2019.4203. Epub 2019 May 20.
14 Characteristic patterns of HOX gene expression in different types of human leukemia.Int J Cancer. 1993 Jan 21;53(2):237-44. doi: 10.1002/ijc.2910530211.
15 Transcriptional activation of EGFR by HOXB5 and its role in breast cancer cell invasion.Biochem Biophys Res Commun. 2018 Sep 18;503(4):2924-2930. doi: 10.1016/j.bbrc.2018.08.071. Epub 2018 Aug 13.
16 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
17 Constitutive gene expression predisposes morphogen-mediated cell fate responses of NT2/D1 and 27X-1 human embryonal carcinoma cells. Stem Cells. 2007 Mar;25(3):771-8. doi: 10.1634/stemcells.2006-0271. Epub 2006 Nov 30.
18 Epigenetic changes in individuals with arsenicosis. Chem Res Toxicol. 2011 Feb 18;24(2):165-7. doi: 10.1021/tx1004419. Epub 2011 Feb 4.
19 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
20 Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
21 Curcumin restores corticosteroid function in monocytes exposed to oxidants by maintaining HDAC2. Am J Respir Cell Mol Biol. 2008 Sep;39(3):312-23. doi: 10.1165/rcmb.2008-0012OC. Epub 2008 Apr 17.
22 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
23 Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
24 Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.