Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUE978R)

• DOT Name: F-box only protein 32 (FBXO32)
• Synonyms: Atrogin-1; Muscle atrophy F-box protein; MAFbx
• Gene Name: FBXO32
• Related Disease:
  Advanced cancer
  Atrial fibrillation
  Bipolar disorder
  Breast cancer
  Breast carcinoma
  Carcinoma of esophagus
  Cerebellar ataxia
  Chronic obstructive pulmonary disease
  Colorectal carcinoma
  Dilated cardiomyopathy 1A
  Esophageal cancer
  Esophageal squamous cell carcinoma
  Kidney failure
  Myocardial infarction
  Myopathy
  Myositis disease
  Neoplasm
  Neoplasm of esophagus
  Open-angle glaucoma
  Pulmonary fibrosis
  Spinal muscular atrophy
  Type-1/2 diabetes
  Amyotrophic lateral sclerosis
  Chronic kidney disease
  Chronic renal failure
  Familial atrial fibrillation
  Gastric cancer
  Lung cancer
  Lung carcinoma
  Metastatic malignant neoplasm
  Pancreatic cancer
  Stomach cancer
  Arthritis
  Cardiomyopathy
  Dilated cardiomyopathy
• UniProt ID: FBX32_HUMAN
• Sequence:
  MPFLGQDWRSPGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVA
  AKKRKKDMLNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFN
  YVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTL
  VQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRL
  SDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKL
  VRCYPRKEQYGDTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF
• Function: Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins during skeletal muscle atrophy. Recognizes TERF1.
• Tissue Specificity: Specifically expressed in cardiac and skeletal muscle.
• KEGG Pathway: FoxO sig.ling pathway (hsa04068)
• Reactome Pathway:
  FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes (R-HSA-9615017)
  Antigen processing (R-HSA-983168)
  Neddylation (R-HSA-8951664)

Molecular Interaction Atlas (MIA) of This DOT

35 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Atrial fibrillation	DIS15W6U	Strong	Genetic Variation	[2]
Bipolar disorder	DISAM7J2	Strong	Genetic Variation	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[5]
Cerebellar ataxia	DIS9IRAV	Strong	Altered Expression	[6]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Biomarker	[7]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[8]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Genetic Variation	[9]
Esophageal cancer	DISGB2VN	Strong	Altered Expression	[5]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[5]
Kidney failure	DISOVQ9P	Strong	Biomarker	[10]
Myocardial infarction	DIS655KI	Strong	Biomarker	[11]
Myopathy	DISOWG27	Strong	Biomarker	[12]
Myositis disease	DISCIXF0	Strong	Biomarker	[13]
Neoplasm	DISZKGEW	Strong	Biomarker	[8]
Neoplasm of esophagus	DISOLKAQ	Strong	Altered Expression	[5]
Open-angle glaucoma	DISSZEE8	Strong	Genetic Variation	[14]
Pulmonary fibrosis	DISQKVLA	Strong	Biomarker	[15]
Spinal muscular atrophy	DISTLKOB	Strong	Biomarker	[16]
Type-1/2 diabetes	DISIUHAP	Strong	Altered Expression	[17]
Amyotrophic lateral sclerosis	DISF7HVM	moderate	Biomarker	[18]
Chronic kidney disease	DISW82R7	moderate	Genetic Variation	[19]
Chronic renal failure	DISGG7K6	moderate	Biomarker	[20]
Familial atrial fibrillation	DISL4AGF	moderate	Biomarker	[2]
Gastric cancer	DISXGOUK	moderate	Biomarker	[21]
Lung cancer	DISCM4YA	moderate	Biomarker	[22]
Lung carcinoma	DISTR26C	moderate	Biomarker	[22]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[23]
Pancreatic cancer	DISJC981	moderate	Biomarker	[24]
Stomach cancer	DISKIJSX	moderate	Biomarker	[21]
Arthritis	DIST1YEL	Disputed	Altered Expression	[25]
Cardiomyopathy	DISUPZRG	Limited	Biomarker	[26]
Dilated cardiomyopathy	DISX608J	Limited	Genetic Variation	[26]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
DTI-015	DMXZRW0	Approved	F-box only protein 32 (FBXO32) affects the response to substance of DTI-015.	[53]

29 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of F-box only protein 32 (FBXO32).	[27]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of F-box only protein 32 (FBXO32).	[28]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of F-box only protein 32 (FBXO32).	[29]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of F-box only protein 32 (FBXO32).	[30]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of F-box only protein 32 (FBXO32).	[31]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of F-box only protein 32 (FBXO32).	[33]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of F-box only protein 32 (FBXO32).	[34]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of F-box only protein 32 (FBXO32).	[35]
Marinol	DM70IK5	Approved	Marinol increases the expression of F-box only protein 32 (FBXO32).	[36]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of F-box only protein 32 (FBXO32).	[37]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of F-box only protein 32 (FBXO32).	[36]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of F-box only protein 32 (FBXO32).	[38]
Lindane	DMB8CNL	Approved	Lindane increases the expression of F-box only protein 32 (FBXO32).	[34]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of F-box only protein 32 (FBXO32).	[39]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of F-box only protein 32 (FBXO32).	[40]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of F-box only protein 32 (FBXO32).	[41]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of F-box only protein 32 (FBXO32).	[42]
GSK2110183	DMZHB37	Phase 2	GSK2110183 increases the expression of F-box only protein 32 (FBXO32).	[43]
PEITC	DMOMN31	Phase 2	PEITC increases the expression of F-box only protein 32 (FBXO32).	[44]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of F-box only protein 32 (FBXO32).	[46]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of F-box only protein 32 (FBXO32).	[47]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of F-box only protein 32 (FBXO32).	[48]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of F-box only protein 32 (FBXO32).	[41]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of F-box only protein 32 (FBXO32).	[49]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of F-box only protein 32 (FBXO32).	[50]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of F-box only protein 32 (FBXO32).	[34]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of F-box only protein 32 (FBXO32).	[51]
Rapamycin Immunosuppressant Drug	DM678IB	Investigative	Rapamycin Immunosuppressant Drug increases the expression of F-box only protein 32 (FBXO32).	[34]
CHLORANIL	DMCHGF1	Investigative	CHLORANIL increases the expression of F-box only protein 32 (FBXO32).	[52]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of F-box only protein 32 (FBXO32).	[32]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of F-box only protein 32 (FBXO32).	[45]

References

• [1] A Chalcone from Ashitaba (Angelica keiskei) Stimulates Myoblast Differentiation and Inhibits Dexamethasone-Induced Muscle Atrophy.Nutrients. 2019 Oct 10;11(10):2419. doi: 10.3390/nu11102419.
• [2] Multi-ethnic genome-wide association study for atrial fibrillation.Nat Genet. 2018 Jun 11;50(9):1225-1233. doi: 10.1038/s41588-018-0133-9.
• [3] Fine-mapping scan of bipolar disorder susceptibility loci in Latino pedigrees.Am J Med Genet B Neuropsychiatr Genet. 2019 Apr;180(3):213-222. doi: 10.1002/ajmg.b.32715. Epub 2019 Feb 19.
• [4] FBXO32 suppresses breast cancer tumorigenesis through targeting KLF4 to proteasomal degradation.Oncogene. 2017 Jun 8;36(23):3312-3321. doi: 10.1038/onc.2016.479. Epub 2017 Jan 9.
• [5] Aberrant methylation and decreased expression of the TGF-/Smad target gene FBXO32 in esophageal squamous cell carcinoma.Cancer. 2014 Aug 15;120(16):2412-23. doi: 10.1002/cncr.28764. Epub 2014 May 2.
• [6] Endophilin-A Deficiency Induces the Foxo3a-Fbxo32 Network in the Brain and Causes Dysregulation of Autophagy and the Ubiquitin-Proteasome System.Cell Rep. 2016 Oct 18;17(4):1071-1086. doi: 10.1016/j.celrep.2016.09.058. Epub 2016 Oct 6.
• [7] Using laser capture microdissection to study fiber specific signaling in locomotor muscle in COPD: A pilot study.Muscle Nerve. 2017 Jun;55(6):902-912. doi: 10.1002/mus.25423. Epub 2017 Feb 3.
• [8] Preliminary Study of the Role F-Box Protein 32 (FBXO32) in Colorectal Neoplasms Through the Transforming Growth Factor beta (TGF-)/Smad4 Signalling Pathway.Med Sci Monit. 2018 Feb 21;24:1080-1088. doi: 10.12659/msm.908030.
• [9] FBXO32, encoding a member of the SCF complex, is mutated in dilated cardiomyopathy.Genome Biol. 2016 Jan 11;17:2. doi: 10.1186/s13059-015-0861-4.
• [10] eIF3-f function in skeletal muscles: to stand at the crossroads of atrophy and hypertrophy.Cell Cycle. 2008 Jun 15;7(12):1698-701. doi: 10.4161/cc.7.12.6090. Epub 2008 Jun 11.
• [11] Endogenous muscle atrophy F-box is involved in the development of cardiac rupture after myocardial infarction.J Mol Cell Cardiol. 2019 Jan;126:1-12. doi: 10.1016/j.yjmcc.2018.11.002. Epub 2018 Nov 6.
• [12] The muscle-specific ubiquitin ligase atrogin-1/MAFbx mediates statin-induced muscle toxicity.J Clin Invest. 2007 Dec;117(12):3940-51. doi: 10.1172/JCI32741.
• [13] l-arginine modulates inflammation and muscle regulatory genes after a single session of resistance exercise in rats.Scand J Med Sci Sports. 2018 Feb;28(2):425-435. doi: 10.1111/sms.12935. Epub 2017 Aug 4.
• [14] A multiethnic genome-wide association study of primary open-angle glaucoma identifies novel risk loci.Nat Commun. 2018 Jun 11;9(1):2278. doi: 10.1038/s41467-018-04555-4.
• [15] Elevation of IL-6 and IL-33 Levels in Serum Associated with Lung Fibrosis and Skeletal Muscle Wasting in a Bleomycin-Induced Lung Injury Mouse Model.Mediators Inflamm. 2019 Mar 27;2019:7947596. doi: 10.1155/2019/7947596. eCollection 2019.
• [16] Loganin possesses neuroprotective properties, restores SMN protein and activates protein synthesis positive regulator Akt/mTOR in experimental models of spinal muscular atrophy.Pharmacol Res. 2016 Sep;111:58-75. doi: 10.1016/j.phrs.2016.05.023. Epub 2016 May 27.
• [17] F-box protein-32 down-regulates small-conductance calcium-activated potassium channel 2 in diabetic mouse atria.J Biol Chem. 2019 Mar 15;294(11):4160-4168. doi: 10.1074/jbc.RA118.003837. Epub 2019 Jan 11.
• [18] Neuronal NOS is dislocated during muscle atrophy in amyotrophic lateral sclerosis.J Neurol Sci. 2010 Jul 15;294(1-2):95-101. doi: 10.1016/j.jns.2010.03.022.
• [19] Systemic inflammation is associated with exaggerated skeletal muscle protein catabolism in maintenance hemodialysis patients.JCI Insight. 2017 Nov 16;2(22):e95185. doi: 10.1172/jci.insight.95185. eCollection 2017 Nov 16.
• [20] Astragalus polysaccharide, a component of traditional Chinese medicine, inhibits muscle cell atrophy (cachexia) in an in vivo and in vitro rat model of chronic renal failure by activating the ubiquitin-proteasome pathway.Exp Ther Med. 2017 Jul;14(1):91-96. doi: 10.3892/etm.2017.4492. Epub 2017 May 22.
• [21] EZH2 contributes to 5-FU resistance in gastric cancer by epigenetically suppressing FBXO32 expression.Onco Targets Ther. 2018 Nov 5;11:7853-7864. doi: 10.2147/OTT.S180131. eCollection 2018.
• [22] Inactivation of the ubiquitin-specific protease 19 deubiquitinating enzyme protects against muscle wasting.FASEB J. 2015 Sep;29(9):3889-98. doi: 10.1096/fj.15-270579. Epub 2015 Jun 5.
• [23] FBXO32 promotes microenvironment underlying epithelial-mesenchymal transition via CtBP1 during tumour metastasis and brain development.Nat Commun. 2017 Nov 15;8(1):1523. doi: 10.1038/s41467-017-01366-x.
• [24] 3F-Box protein 32 degrades ataxia telangiectasia and Rad3-related and regulates DNA damage response induced by gemcitabine in pancreatic cancer.Oncol Lett. 2018 Jun;15(6):8878-8884. doi: 10.3892/ol.2018.8367. Epub 2018 Mar 28.
• [25] Insulin treatment reverses the increase in atrogin-1 expression in atrophied skeletal muscles of diabetic rats with acute joint inflammation.Ther Clin Risk Manag. 2018 Feb 14;14:275-286. doi: 10.2147/TCRM.S142948. eCollection 2018.
• [26] A substitution mutation in cardiac ubiquitin ligase, FBXO32, is associated with an autosomal recessive form of dilated cardiomyopathy.BMC Med Genet. 2016 Jan 14;17:3. doi: 10.1186/s12881-016-0267-5.
• [27] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [28] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [29] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [30] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [31] Epidermal growth factor receptor signalling in human breast cancer cells operates parallel to estrogen receptor alpha signalling and results in tamoxifen insensitive proliferation. BMC Cancer. 2014 Apr 23;14:283.
• [32] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [33] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [34] Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
• [35] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [36] Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
• [37] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [38] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [39] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [40] A novel long noncoding RNA AK001796 acts as an oncogene and is involved in cell growth inhibition by resveratrol in lung cancer. Toxicol Appl Pharmacol. 2015 Jun 1;285(2):79-88.
• [41] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [42] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [43] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [44] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [45] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [46] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [47] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [48] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [49] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [50] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [51] Effects of nickel treatment on H3K4 trimethylation and gene expression. PLoS One. 2011 Mar 24;6(3):e17728. doi: 10.1371/journal.pone.0017728.
• [52] Redox-active quinones induces genome-wide DNA methylation changes by an iron-mediated and Tet-dependent mechanism. Nucleic Acids Res. 2014 Feb;42(3):1593-605. doi: 10.1093/nar/gkt1090. Epub 2013 Nov 8.
• [53] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.