Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUJHIJW)

• DOT Name: Neuroserpin (SERPINI1)
• Synonyms: Peptidase inhibitor 12; PI-12; Serpin I1
• Gene Name: SERPINI1
• Related Disease:
  Adult glioblastoma
  Glioblastoma multiforme
  Progressive myoclonus epilepsy
  Action myoclonus-renal failure syndrome
  Alzheimer disease
  Brain cancer
  Brain disease
  Brain neoplasm
  Cerebral cavernous malformation
  Colorectal carcinoma
  Dementia
  Dentatorubral-pallidoluysian atrophy
  Familial encephalopathy with neuroserpin inclusion bodies
  Frontotemporal dementia
  Gastric cancer
  Hepatocellular carcinoma
  Lafora disease
  Neoplasm
  Pick disease
  Prostate cancer
  Prostate carcinoma
  Schizophrenia
  Status epilepticus seizure
  Unverricht-Lundborg syndrome
  Advanced cancer
  Pulmonary emphysema
• UniProt ID: NEUS_HUMAN
• PDB ID: 3F02; 3F5N; 3FGQ
• Pfam ID: PF00079
• Sequence:
  MAFLGLFSLLVLQSMATGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMM
  ELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHV
  NEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLAL
  INAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQ
  VLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQE
  IDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAI
  SRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL
• Function: Serine protease inhibitor that inhibits plasminogen activators and plasmin but not thrombin. May be involved in the formation or reorganization of synaptic connections as well as for synaptic plasticity in the adult nervous system. May protect neurons from cell damage by tissue-type plasminogen activator (Probable).
• Tissue Specificity: Detected in brain cortex and hippocampus pyramidal neurons (at protein level) . Detected in cerebrospinal fluid (at protein level) . Predominantly expressed in the brain .

Molecular Interaction Atlas (MIA) of This DOT

26 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Definitive	Biomarker	[1]
Glioblastoma multiforme	DISK8246	Definitive	Biomarker	[1]
Progressive myoclonus epilepsy	DISAMCNS	Definitive	Autosomal dominant	[2]
Action myoclonus-renal failure syndrome	DISI2BZN	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Brain cancer	DISBKFB7	Strong	Altered Expression	[5]
Brain disease	DIS6ZC3X	Strong	Genetic Variation	[5]
Brain neoplasm	DISY3EKS	Strong	Altered Expression	[5]
Cerebral cavernous malformation	DISLKNYA	Strong	Genetic Variation	[6]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[7]
Dementia	DISXL1WY	Strong	Biomarker	[8]
Dentatorubral-pallidoluysian atrophy	DISHWE0K	Strong	Biomarker	[3]
Familial encephalopathy with neuroserpin inclusion bodies	DISNQHXO	Strong	Autosomal dominant	[9]
Frontotemporal dementia	DISKYHXL	Strong	Genetic Variation	[10]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[11]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[12]
Lafora disease	DIS83JHH	Strong	Biomarker	[13]
Neoplasm	DISZKGEW	Strong	Altered Expression	[11]
Pick disease	DISP6X50	Strong	Genetic Variation	[10]
Prostate cancer	DISF190Y	Strong	Altered Expression	[14]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[14]
Schizophrenia	DISSRV2N	Strong	Biomarker	[15]
Status epilepticus seizure	DISY3BIC	Strong	Genetic Variation	[16]
Unverricht-Lundborg syndrome	DISG4WLX	Strong	Genetic Variation	[17]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[18]
Pulmonary emphysema	DIS5M7HZ	moderate	Genetic Variation	[19]

22 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Neuroserpin (SERPINI1).	[20]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Neuroserpin (SERPINI1).	[21]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Neuroserpin (SERPINI1).	[22]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Neuroserpin (SERPINI1).	[23]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Neuroserpin (SERPINI1).	[24]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Neuroserpin (SERPINI1).	[25]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Neuroserpin (SERPINI1).	[26]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Neuroserpin (SERPINI1).	[27]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Neuroserpin (SERPINI1).	[28]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Neuroserpin (SERPINI1).	[29]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Neuroserpin (SERPINI1).	[28]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Neuroserpin (SERPINI1).	[30]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Neuroserpin (SERPINI1).	[31]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Neuroserpin (SERPINI1).	[32]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Neuroserpin (SERPINI1).	[33]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of Neuroserpin (SERPINI1).	[34]
PEITC	DMOMN31	Phase 2	PEITC increases the expression of Neuroserpin (SERPINI1).	[35]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Neuroserpin (SERPINI1).	[36]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Neuroserpin (SERPINI1).	[37]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Neuroserpin (SERPINI1).	[38]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Neuroserpin (SERPINI1).	[39]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of Neuroserpin (SERPINI1).	[40]

References

• [1] Common variation in genes related to innate immunity and risk of adult glioma.Cancer Epidemiol Biomarkers Prev. 2009 May;18(5):1651-8. doi: 10.1158/1055-9965.EPI-08-1041.
• [2] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [3] A recurrent de novo mutation in KCNC1 causes progressive myoclonus epilepsy. Nat Genet. 2015 Jan;47(1):39-46. doi: 10.1038/ng.3144. Epub 2014 Nov 17.
• [4] Neuroserpin binds Abeta and is a neuroprotective component of amyloid plaques in Alzheimer disease.J Biol Chem. 2006 Sep 29;281(39):29268-77. doi: 10.1074/jbc.M600690200. Epub 2006 Jul 17.
• [5] c-Myc regulates the coordinated transcription of brain disease-related PDCD10-SERPINI1 bidirectional gene pair.Mol Cell Neurosci. 2009 Sep;42(1):23-32. doi: 10.1016/j.mcn.2009.05.001. Epub 2009 May 13.
• [6] CCM3/SERPINI1 bidirectional promoter variants in patients with cerebral cavernous malformations: a molecular and functional study.BMC Med Genet. 2016 Oct 13;17(1):74. doi: 10.1186/s12881-016-0332-0.
• [7] SERPINI1 regulates epithelial-mesenchymal transition in an orthotopic implantation model of colorectal cancer.Cancer Sci. 2016 May;107(5):619-28. doi: 10.1111/cas.12909. Epub 2016 Mar 28.
• [8] Identification of rare genetic variants in Italian patients with dementia by targeted gene sequencing.Neurobiol Aging. 2018 Jun;66:180.e23-180.e31. doi: 10.1016/j.neurobiolaging.2018.02.006. Epub 2018 Feb 13.
• [9] Association between conformational mutations in neuroserpin and onset and severity of dementia. Lancet. 2002 Jun 29;359(9325):2242-7. doi: 10.1016/S0140-6736(02)09293-0.
• [10] Early onset autosomal dominant dementia with ataxia, extrapyramidal features, and epilepsy.Neurology. 2002 Mar 26;58(6):922-8. doi: 10.1212/wnl.58.6.922.
• [11] MicroRNA-21 inhibits Serpini1, a gene with novel tumour suppressive effects in gastric cancer.Dig Liver Dis. 2012 Jul;44(7):589-96. doi: 10.1016/j.dld.2012.02.016. Epub 2012 Mar 28.
• [12] New genetic markers for diagnosis of hepatitis C related hepatocellular carcinoma in Egyptian patients.J Gastrointestin Liver Dis. 2013 Dec;22(4):419-25.
• [13] Persistent accumulation of unrepaired DNA damage in rat cortical neurons: nuclear organization and ChIP-seq analysis of damaged DNA.Acta Neuropathol Commun. 2018 Jul 26;6(1):68. doi: 10.1186/s40478-018-0573-6.
• [14] Neuroserpin (PI-12) is upregulated in high-grade prostate cancer and is associated with survival.Int J Cancer. 2005 Jul 20;115(6):911-6. doi: 10.1002/ijc.20967.
• [15] Gene expression of metabolic enzymes and a protease inhibitor in the prefrontal cortex are decreased in schizophrenia.Neurochem Res. 2004 Jun;29(6):1245-55. doi: 10.1023/b:nere.0000023611.99452.47.
• [16] Neuroserpin mutation causes electrical status epilepticus of slow-wave sleep.Neurology. 2008 Jul 1;71(1):64-6. doi: 10.1212/01.wnl.0000316306.08751.28.
• [17] SERPINI1 pathogenic variants: An emerging cause of childhood-onset progressive myoclonic epilepsy.Am J Med Genet A. 2017 Sep;173(9):2456-2460. doi: 10.1002/ajmg.a.38317. Epub 2017 Jun 20.
• [18] In-depth characterization of the secretome of colorectal cancer metastatic cells identifies key proteins in cell adhesion, migration, and invasion.Mol Cell Proteomics. 2013 Jun;12(6):1602-20. doi: 10.1074/mcp.M112.022848. Epub 2013 Feb 26.
• [19] Cellular Models for the Serpinopathies.Methods Mol Biol. 2018;1826:109-121. doi: 10.1007/978-1-4939-8645-3_7.
• [20] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [21] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [22] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [23] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [24] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [25] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [26] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [27] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [28] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [29] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [30] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [31] Evaluation of developmental toxicity using undifferentiated human embryonic stem cells. J Appl Toxicol. 2015 Feb;35(2):205-18.
• [32] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [33] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [34] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [35] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [36] BET bromodomain inhibition as a therapeutic strategy to target c-Myc. Cell. 2011 Sep 16;146(6):904-17.
• [37] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [38] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [39] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [40] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.