Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUQ9QS9)

• DOT Name: La-related protein 6 (LARP6)
• Synonyms: Acheron; Achn; La ribonucleoprotein domain family member 6
• Gene Name: LARP6
• Related Disease:
  Bladder cancer
  leukaemia
  Leukemia
  Urinary bladder cancer
  Advanced cancer
  Breast cancer
  Breast neoplasm
  Clear cell renal carcinoma
  Endometrium adenocarcinoma
  Hepatocellular carcinoma
  Immunodeficiency
  Kidney cancer
  Laryngeal carcinoma
  Lung cancer
  Lung carcinoma
  Lupus
  Malignant soft tissue neoplasm
  Papillary renal cell carcinoma
  Prostate cancer
  Prostate carcinoma
  Sarcoma
  Systemic lupus erythematosus
  Testicular cancer
  Urinary bladder neoplasm
  Carcinoma
  Cervical cancer
  Cervical carcinoma
  Melanoma
  Prostate adenocarcinoma
• UniProt ID: LARP6_HUMAN
• PDB ID: 2MTF; 2MTG
• Pfam ID: PF05383 ; PF12901
• Sequence:
  MAQSGGEARPGPKTAVQIRVAIQEAEDVDELEDEEEGAETRGAGDPARYLSPGWGSASEE
  EPSRGHSGTTASGGENEREDLEQEWKPPDEELIKKLVDQIEFYFSDENLEKDAFLLKHVR
  RNKLGYVSVKLLTSFKKVKHLTRDWRTTAHALKYSVVLELNEDHRKVRRTTPVPLFPNEN
  LPSKMLLVYDLYLSPKLWALATPQKNGRVQEKVMEHLLKLFGTFGVISSVRILKPGRELP
  PDIRRISSRYSQVGTQECAIVEFEEVEAAIKAHEFMITESQGKENMKAVLIGMKPPKKKP
  AKDKNHDEEPTASIHLNKSLNKRVEELQYMGDESSANSSSDPESNPTSPMAGRRHAATNK
  LSPSGHQNLFLSPNASPCTSPWSSPLAQRKGVSRKSPLAEEGRLNCSTSPEIFRKCMDYS
  SDSSVTPSGSPWVRRRRQAEMGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRG
  FHGHERSRACV
• Function: Regulates the coordinated translation of type I collagen alpha-1 and alpha-2 mRNAs, CO1A1 and CO1A2. Stabilizes mRNAs through high-affinity binding of a stem-loop structure in their 5' UTR. This regulation requires VIM and MYH10 filaments, and the helicase DHX9.
• Tissue Specificity: Expressed in numerous tissues.

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bladder cancer	DISUHNM0	Definitive	Biomarker	[1]
leukaemia	DISS7D1V	Definitive	Altered Expression	[2]
Leukemia	DISNAKFL	Definitive	Altered Expression	[2]
Urinary bladder cancer	DISDV4T7	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[5]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[6]
Endometrium adenocarcinoma	DISY6744	Strong	Biomarker	[7]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[4]
Immunodeficiency	DIS093I0	Strong	Biomarker	[8]
Kidney cancer	DISBIPKM	Strong	Biomarker	[9]
Laryngeal carcinoma	DISNHCIV	Strong	Genetic Variation	[10]
Lung cancer	DISCM4YA	Strong	Biomarker	[11]
Lung carcinoma	DISTR26C	Strong	Biomarker	[11]
Lupus	DISOKJWA	Strong	Biomarker	[5]
Malignant soft tissue neoplasm	DISTC6NO	Strong	Biomarker	[12]
Papillary renal cell carcinoma	DIS25HBV	Strong	Biomarker	[13]
Prostate cancer	DISF190Y	Strong	Genetic Variation	[14]
Prostate carcinoma	DISMJPLE	Strong	Genetic Variation	[14]
Sarcoma	DISZDG3U	Strong	Biomarker	[12]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[5]
Testicular cancer	DIS6HNYO	Strong	Genetic Variation	[14]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[1]
Carcinoma	DISH9F1N	moderate	Biomarker	[15]
Cervical cancer	DISFSHPF	Limited	Biomarker	[16]
Cervical carcinoma	DIST4S00	Limited	Biomarker	[16]
Melanoma	DIS1RRCY	Limited	Biomarker	[17]
Prostate adenocarcinoma	DISBZYU8	Limited	Biomarker	[17]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Topotecan	DMP6G8T	Approved	La-related protein 6 (LARP6) affects the response to substance of Topotecan.	[41]

24 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of La-related protein 6 (LARP6).	[18]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of La-related protein 6 (LARP6).	[19]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of La-related protein 6 (LARP6).	[20]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of La-related protein 6 (LARP6).	[21]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of La-related protein 6 (LARP6).	[22]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of La-related protein 6 (LARP6).	[23]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of La-related protein 6 (LARP6).	[24]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of La-related protein 6 (LARP6).	[25]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of La-related protein 6 (LARP6).	[26]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of La-related protein 6 (LARP6).	[27]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of La-related protein 6 (LARP6).	[28]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of La-related protein 6 (LARP6).	[29]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of La-related protein 6 (LARP6).	[30]
Menadione	DMSJDTY	Approved	Menadione affects the expression of La-related protein 6 (LARP6).	[27]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of La-related protein 6 (LARP6).	[31]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of La-related protein 6 (LARP6).	[32]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of La-related protein 6 (LARP6).	[33]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of La-related protein 6 (LARP6).	[34]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of La-related protein 6 (LARP6).	[35]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of La-related protein 6 (LARP6).	[36]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of La-related protein 6 (LARP6).	[37]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of La-related protein 6 (LARP6).	[39]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of La-related protein 6 (LARP6).	[25]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of La-related protein 6 (LARP6).	[40]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of La-related protein 6 (LARP6).	[38]

References

• [1] Significant antitumoral activity of cationic multilamellar liposomes containing human IFN-beta gene against human renal cell carcinoma.Clin Cancer Res. 2003 Mar;9(3):1129-35.
• [2] Design, synthesis and evaluation of novel sulfonamides as potential anticancer agents.Comput Biol Chem. 2018 Jun;74:294-303. doi: 10.1016/j.compbiolchem.2018.04.006. Epub 2018 Apr 10.
• [3] Identification of N-arylsulfonylpyrimidones as anticancer agents.Arch Pharm Res. 2018 Mar;41(3):251-258. doi: 10.1007/s12272-018-1003-9. Epub 2018 Jan 13.
• [4] Corosolic Acid Induces Non-Apoptotic Cell Death through Generation of Lipid Reactive Oxygen Species Production in Human Renal Carcinoma Caki Cells.Int J Mol Sci. 2018 Apr 27;19(5):1309. doi: 10.3390/ijms19051309.
• [5] The novel lupus antigen related protein acheron enhances the development of human breast cancer.Int J Cancer. 2012 Feb 1;130(3):544-54. doi: 10.1002/ijc.26015. Epub 2011 May 9.
• [6] Overexpression of HHLA2 in human clear cell renal cell carcinoma is significantly associated with poor survival of the patients.Cancer Cell Int. 2019 Apr 16;19:101. doi: 10.1186/s12935-019-0813-2. eCollection 2019.
• [7] Synthesis and structure-activity studies on novel analogs of human growth hormone releasing hormone (GHRH) with enhanced inhibitory activities on tumor growth.Peptides. 2017 Mar;89:60-70. doi: 10.1016/j.peptides.2017.01.009. Epub 2017 Jan 24.
• [8] BMP-2 inhibits tumor growth of human renal cell carcinoma and induces bone formation.Int J Cancer. 2012 Oct 15;131(8):1941-50. doi: 10.1002/ijc.27444. Epub 2012 Mar 8.
• [9] Human renal adipose tissue from normal and tumor kidney: its influence on renal cell carcinoma.Oncotarget. 2019 Sep 10;10(52):5454-5467. doi: 10.18632/oncotarget.27157. eCollection 2019 Sep 10.
• [10] The distribution and expression profiles of human Aspartyl/Asparaginyl beta-hydroxylase in tumor cell lines and human tissues.Oncol Rep. 2010 Nov;24(5):1257-64. doi: 10.3892/or_00000980.
• [11] Maritoclax Enhances TRAIL-Induced Apoptosis via CHOP-Mediated Upregulation of DR5 and miR-708-Mediated Downregulation of cFLIP.Molecules. 2018 Nov 20;23(11):3030. doi: 10.3390/molecules23113030.
• [12] Retinoic acid receptor and retinoid X receptor expression in retinoic acid-resistant human tumor cell lines.Mol Carcinog. 1993;8(2):112-22. doi: 10.1002/mc.2940080208.
• [13] Drug resistance in papillary RCC: from putative mechanisms to clinical practicalities.Nat Rev Urol. 2019 Nov;16(11):655-673. doi: 10.1038/s41585-019-0233-z. Epub 2019 Oct 10.
• [14] The study of PSA gene expression on urogenital cell lines.Int J Urol. 1999 Oct;6(10):526-31. doi: 10.1046/j.1442-2042.1999.00104.x.
• [15] Functional analysis of fatty acid binding protein 7 and its effect on fatty acid of renal cell carcinoma cell lines.BMC Cancer. 2017 Mar 14;17(1):192. doi: 10.1186/s12885-017-3184-x.
• [16] Up-regulation of 5-lipoxygenase by inhibition of cathepsin G enhances TRAIL-induced apoptosis through down-regulation of survivin.Oncotarget. 2017 Nov 20;8(63):106672-106684. doi: 10.18632/oncotarget.22508. eCollection 2017 Dec 5.
• [17] Withanolides from Aeroponically Grown Physalis peruviana and Their Selective Cytotoxicity to Prostate Cancer and Renal Carcinoma Cells.J Nat Prod. 2017 Jul 28;80(7):1981-1991. doi: 10.1021/acs.jnatprod.6b01129. Epub 2017 Jun 15.
• [18] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [19] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [20] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [21] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [22] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [23] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [24] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [25] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [26] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [27] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [28] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [29] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [30] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [31] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [32] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [33] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [34] Gene expression signatures after ethanol exposure in differentiating embryoid bodies. Toxicol In Vitro. 2018 Feb;46:66-76.
• [35] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [36] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [37] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [38] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [39] Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
• [40] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [41] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.