Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVPG39Z)

• DOT Name: Calponin-1 (CNN1)
• Synonyms: Basic calponin; Calponin H1, smooth muscle
• Gene Name: CNN1
• Related Disease:
  Epithelial ovarian cancer
  Ovarian cancer
  Ovarian neoplasm
  Advanced cancer
  Atypical teratoid/rhabdoid tumour
  Bone osteosarcoma
  Cardiac failure
  Colonic neoplasm
  Congestive heart failure
  Dilated cardiomyopathy
  Dilated cardiomyopathy 1A
  Glomerulonephritis
  Hepatocellular carcinoma
  High blood pressure
  Lung cancer
  Lung carcinoma
  Osteosarcoma
  Melanoma
  Neuroblastoma
  Malignant rhabdoid tumour
  Marfan syndrome
  Neoplasm
  Platelet-type bleeding disorder 10
• UniProt ID: CNN1_HUMAN
• PDB ID: 1WYP
• Pfam ID: PF00402 ; PF00307
• Sequence:
  MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIIL
  CEFINKLQPGSVKKINESTQNWHQLENIGNFIKAITKYGVKPHDIFEANDLFENTNHTQV
  QSTLLALASMAKTKGNKVNVGVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQGMT
  AYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDT
  LNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNSA
• Function: Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.
• Tissue Specificity: Smooth muscle, and tissues containing significant amounts of smooth muscle.

Molecular Interaction Atlas (MIA) of This DOT

23 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Epithelial ovarian cancer	DIS56MH2	Definitive	Biomarker	[1]
Ovarian cancer	DISZJHAP	Definitive	Biomarker	[1]
Ovarian neoplasm	DISEAFTY	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Atypical teratoid/rhabdoid tumour	DIS1FA0D	Strong	Biomarker	[2]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[3]
Cardiac failure	DISDC067	Strong	Biomarker	[4]
Colonic neoplasm	DISSZ04P	Strong	Altered Expression	[5]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[4]
Dilated cardiomyopathy	DISX608J	Strong	Genetic Variation	[4]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Biomarker	[4]
Glomerulonephritis	DISPZIQ3	Strong	Altered Expression	[6]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[7]
High blood pressure	DISY2OHH	Strong	Biomarker	[8]
Lung cancer	DISCM4YA	Strong	Genetic Variation	[9]
Lung carcinoma	DISTR26C	Strong	Genetic Variation	[9]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[3]
Melanoma	DIS1RRCY	moderate	Biomarker	[10]
Neuroblastoma	DISVZBI4	moderate	Biomarker	[11]
Malignant rhabdoid tumour	DIS46HZU	Limited	Altered Expression	[12]
Marfan syndrome	DISVEUWZ	Limited	Altered Expression	[13]
Neoplasm	DISZKGEW	Limited	Biomarker	[14]
Platelet-type bleeding disorder 10	DISNNCXT	Limited	Altered Expression	[15]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Calponin-1 (CNN1).	[16]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Calponin-1 (CNN1).	[35]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Calponin-1 (CNN1).	[17]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Calponin-1 (CNN1).	[18]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Calponin-1 (CNN1).	[19]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Calponin-1 (CNN1).	[20]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Calponin-1 (CNN1).	[21]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Calponin-1 (CNN1).	[22]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Calponin-1 (CNN1).	[23]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Calponin-1 (CNN1).	[24]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Calponin-1 (CNN1).	[25]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Calponin-1 (CNN1).	[26]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Calponin-1 (CNN1).	[22]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Calponin-1 (CNN1).	[27]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Calponin-1 (CNN1).	[28]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Calponin-1 (CNN1).	[29]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of Calponin-1 (CNN1).	[30]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Calponin-1 (CNN1).	[31]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Calponin-1 (CNN1).	[32]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Calponin-1 (CNN1).	[33]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate decreases the expression of Calponin-1 (CNN1).	[34]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Calponin-1 (CNN1).	[36]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Calponin-1 (CNN1).	[37]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Calponin-1 (CNN1).	[38]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Calponin-1 (CNN1).	[39]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Calponin-1 (CNN1).	[40]
Bisindolylmaleimide-I	DMOQJZC	Investigative	Bisindolylmaleimide-I decreases the expression of Calponin-1 (CNN1).	[34]
Go 6983	DMKVTZN	Investigative	Go 6983 decreases the expression of Calponin-1 (CNN1).	[34]

References

• [1] Identification of the Critical Site of Calponin 1 for Suppression of Ovarian Cancer Properties.Anticancer Res. 2015 Nov;35(11):5993-9.
• [2] Synthesis, characterization, and in vitro cytotoxicity of fatty acyl-CGKRK-chitosan oligosaccharides conjugates for siRNA delivery.Int J Biol Macromol. 2018 Jun;112:694-702. doi: 10.1016/j.ijbiomac.2018.01.213. Epub 2018 Feb 2.
• [3] Expression of the smooth muscle calponin gene in human osteosarcoma and its possible association with prognosis.Int J Cancer. 1998 Jun 19;79(3):245-50. doi: 10.1002/(sici)1097-0215(19980619)79:3<245::aid-ijc6>3.0.co;2-p.
• [4] Calponin1 inhibits dilated cardiomyopathy development in mice through the PKC pathway.Int J Cardiol. 2014 May 1;173(2):146-53. doi: 10.1016/j.ijcard.2014.02.032. Epub 2014 Feb 25.
• [5] Reduction of Calponin h1 expression in human colon cancer blood vessels.Eur J Surg Oncol. 2008 May;34(5):531-7. doi: 10.1016/j.ejso.2007.05.010. Epub 2007 Aug 16.
• [6] Smooth-muscle calponin in mesangial cells: regulation of expression and a role in suppressing glomerulonephritis.J Am Soc Nephrol. 2002 Feb;13(2):322-331. doi: 10.1681/ASN.V132322.
• [7] Simple and rapid radiosynthesis of N-(18)F-labeled glutamic acid as a hepatocellular carcinoma PET tracer.Nucl Med Biol. 2017 Jun;49:38-43. doi: 10.1016/j.nucmedbio.2017.02.003. Epub 2017 Mar 2.
• [8] Double deletion of calponin 1 and calponin 2 in mice decreases systemic blood pressure with blunted length-tension response of aortic smooth muscle.J Mol Cell Cardiol. 2019 Apr;129:49-57. doi: 10.1016/j.yjmcc.2019.01.026. Epub 2019 Jan 29.
• [9] An investigation of the relationship between SULT1A1 Arg(213)His polymorphism and lung cancer susceptibility in a Turkish population.Cell Biochem Funct. 2009 Jun;27(4):211-5. doi: 10.1002/cbf.1558.
• [10] Delivery of PUMA Apoptosis Gene Using Polyethyleneimine-SMCC-TAT/DNA Nanoparticles: Biophysical Characterization and In Vitro Transfection Into Malignant Melanoma Cells.J Biomed Nanotechnol. 2015 Oct;11(10):1776-82. doi: 10.1166/jbn.2015.2151.
• [11] Neuroblastoma cell lines showing smooth muscle cell phenotypes.Diagn Mol Pathol. 2000 Dec;9(4):221-8. doi: 10.1097/00019606-200012000-00007.
• [12] Malignant rhabdoid-tumor cell line showing neural and smooth-muscle-cell phenotypes.Int J Cancer. 1999 Aug 27;82(5):678-86. doi: 10.1002/(sici)1097-0215(19990827)82:5<678::aid-ijc10>3.0.co;2-k.
• [13] Impaired vascular smooth muscle cell force-generating capacity and phenotypic deregulation in Marfan Syndrome mice.Biochim Biophys Acta Mol Basis Dis. 2020 Jan 1;1866(1):165587. doi: 10.1016/j.bbadis.2019.165587. Epub 2019 Oct 31.
• [14] Loss of calponin h1 confers anoikis resistance and tumor progression in the development of high-grade serous carcinoma originating from the fallopian tube epithelium.Oncotarget. 2017 May 19;8(37):61133-61145. doi: 10.18632/oncotarget.18024. eCollection 2017 Sep 22.
• [15] CD36 Enhances Vascular Smooth Muscle Cell Proliferation and Development of Neointimal Hyperplasia.Arterioscler Thromb Vasc Biol. 2019 Feb;39(2):263-275. doi: 10.1161/ATVBAHA.118.312186.
• [16] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [17] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [18] Differentiation of human embryonic stem cells into smooth muscle cells in adherent monolayer culture. Biochem Biophys Res Commun. 2006 Dec 15;351(2):321-7. doi: 10.1016/j.bbrc.2006.09.171. Epub 2006 Oct 17.
• [19] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [20] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [21] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [22] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [23] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [24] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [25] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [26] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [27] Dose- and time-dependent effects of phenobarbital on gene expression profiling in human hepatoma HepaRG cells. Toxicol Appl Pharmacol. 2009 Feb 1;234(3):345-60.
• [28] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [29] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [30] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [31] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [32] Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
• [33] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [34] Possible involvement of protein kinase C activation in differentiation of human umbilical vein endothelium-derived cell into smooth muscle-like cell. Biol Cell. 2004 Sep;96(7):499-508. doi: 10.1016/j.biolcel.2004.04.012.
• [35] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [36] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [37] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [38] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [39] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [40] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.