Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVXW089)

• DOT Name: Microtubule-associated protein 1B (MAP1B)
• Synonyms: MAP-1B
• Gene Name: MAP1B
• Related Disease:
  Alzheimer disease
  Attention deficit hyperactivity disorder
  Classic galactosemia
  Congenital fibrosis of extraocular muscles
  Galactosemia
  Hypothyroidism
  Lung cancer
  Lung carcinoma
  Metastatic malignant neoplasm
  Neoplasm
  Parkinson disease
  Peripheral neuropathy
  Periventricular nodular heterotopia 9
  Proximal spinal muscular atrophy
  Schizophrenia
  Spinal muscular atrophy
  Chronic obstructive pulmonary disease
  Intellectual disability
  Lung neoplasm
  Neuroblastoma
  Periventricular nodular heterotopia
  Nervous system disease
  Adult glioblastoma
  Amyotrophic lateral sclerosis
  Coronary heart disease
  Glioblastoma multiforme
  Glioma
  Nervous system inflammation
  Proliferative vitreoretinopathy
• UniProt ID: MAP1B_HUMAN
• Pfam ID: PF00414
• Sequence:
  MATVVVEATEPEPSGSIANPAASTSPSLSHRFLDSKFYLLVVVGEIVTEEHLRRAIGNIE
  LGIRSWDTNLIECNLDQELKLFVSRHSARFSPEVPGQKILHHRSDVLETVVLINPSDEAV
  STEVRLMITDAARHKLLVLTGQCFENTGELILQSGSFSFQNFIEIFTDQEIGELLSTTHP
  ANKASLTLFCPEEGDWKNSNLDRHNLQDFINIKLNSASILPEMEGLSEFTEYLSESVEVP
  SPFDILEPPTSGGFLKLSKPCCYIFPGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRH
  LDRVDSILLTHIGDDNLPGINSMLQRKIAELEEEQSQGSTTNSDWMKNLISPDLGVVFLN
  VPENLKNPEPNIKMKRSIEEACFTLQYLNKLSMKPEPLFRSVGNTIDPVILFQKMGVGKL
  EMYVLNPVKSSKEMQYFMQQWTGTNKDKAEFILPNGQEVDLPISYLTSVSSLIVWHPANP
  AEKIIRVLFPGNSTQYNILEGLEKLKHLDFLKQPLATQKDLTGQVPTPVVKQTKLKQRAD
  SRESLKPAAKPLPSKSVRKESKEETPEVTKVNHVEKPPKVESKEKVMVKKDKPIKTETKP
  SVTEKEVPSKEEPSPVKAEVAEKQATDVKPKAAKEKTVKKETKVKPEDKKEEKEKPKKEV
  AKKEDKTPIKKEEKPKKEEVKKEVKKEIKKEEKKEPKKEVKKETPPKEVKKEVKKEEKKE
  VKKEEKEPKKEIKKLPKDAKKSSTPLSEAKKPAALKPKVPKKEESVKKDSVAAGKPKEKG
  KIKVIKKEGKAAEAVAAAVGTGATTAAVMAAAGIAAIGPAKELEAERSLMSSPEDLTKDF
  EELKAEEVDVTKDIKPQLELIEDEEKLKETEPVEAYVIQKEREVTKGPAESPDEGITTTE
  GEGECEQTPEELEPVEKQGVDDIEKFEDEGAGFEESSETGDYEEKAETEEAEEPEEDGEE
  HVCVSASKHSPTEDEESAKAEADAYIREKRESVASGDDRAEEDMDEAIEKGEAEQSEEEA
  DEEDKAEDAREEEYEPEKMEAEDYVMAVVDKAAEAGGAEEQYGFLTTPTKQLGAQSPGRE
  PASSIHDETLPGGSESEATASDEENREDQPEEFTATSGYTQSTIEISSEPTPMDEMSTPR
  DVMSDETNNEETESPSQEFVNITKYESSLYSQEYSKPADVTPLNGFSEGSKTDATDGKDY
  NASASTISPPSSMEEDKFSRSALRDAYCSEVKASTTLDIKDSISAVSSEKVSPSKSPSLS
  PSPPSPLEKTPLGERSVNFSLTPNEIKVSAEAEVAPVSPEVTQEVVEEHCASPEDKTLEV
  VSPSQSVTGSAGHTPYYQSPTDEKSSHLPTEVIEKPPAVPVSFEFSDAKDENERASVSPM
  DEPVPDSESPIEKVLSPLRSPPLIGSESAYESFLSADDKASGRGAESPFEEKSGKQGSPD
  QVSPVSEMTSTSLYQDKQEGKSTDFAPIKEDFGQEKKTDDVEAMSSQPALALDERKLGDV
  SPTQIDVSQFGSFKEDTKMSISEGTVSDKSATPVDEGVAEDTYSHMEGVASVSTASVATS
  SFPEPTTDDVSPSLHAEVGSPHSTEVDDSLSVSVVQTPTTFQETEMSPSKEECPRPMSIS
  PPDFSPKTAKSRTPVQDHRSEQSSMSIEFGQESPEQSLAMDFSRQSPDHPTVGAGVLHIT
  ENGPTEVDYSPSDMQDSSLSHKIPPMEEPSYTQDNDLSELISVSQVEASPSTSSAHTPSQ
  IASPLQEDTLSDVAPPRDMSLYASLTSEKVQSLEGEKLSPKSDISPLTPRESSPLYSPTF
  SDSTSAVKEKTATCHSSSSPPIDAASAEPYGFRASVLFDTMQHHLALNRDLSTPGLEKDS
  GGKTPGDFSYAYQKPEETTRSPDEEDYDYESYEKTTRTSDVGGYYYEKIERTTKSPSDSG
  YSYETIGKTTKTPEDGDYSYEIIEKTTRTPEEGGYSYDISEKTTSPPEVSGYSYEKTERS
  RRLLDDISNGYDDSEDGGHTLGDPSYSYETTEKITSFPESEGYSYETSTKTTRTPDTSTY
  CYETAEKITRTPQASTYSYETSDLCYTAEKKSPSEARQDVDLCLVSSCEYKHPKTELSPS
  FINPNPLEWFASEEPTEESEKPLTQSGGAPPPPGGKQQGRQCDETPPTSVSESAPSQTDS
  DVPPETEECPSITADANIDSEDESETIPTDKTVTYKHMDPPPAPVQDRSPSPRHPDVSMV
  DPEALAIEQNLGKALKKDLKEKTKTKKPGTKTKSSSPVKKSDGKSKPLAASPKPAGLKES
  SDKVSRVASPKKKESVEKAAKPTTTPEVKAARGEEKDKETKNAANASASKSAKTATAGPG
  TTKTTKSSAVPPGLPVYLDLCYIPNHSNSKNVDVEFFKRVRSSYYVVSGNDPAAEEPSRA
  VLDALLEGKAQWGSNMQVTLIPTHDSEVMREWYQETHEKQQDLNIMVLASSSTVVMQDES
  FPACKIEL
• Function: Facilitates tyrosination of alpha-tubulin in neuronal microtubules. Phosphorylated MAP1B is required for proper microtubule dynamics and plays a role in the cytoskeletal changes that accompany neuronal differentiation and neurite extension. Possibly MAP1B binds to at least two tubulin subunits in the polymer, and this bridging of subunits might be involved in nucleating microtubule polymerization and in stabilizing microtubules. Acts as a positive cofactor in DAPK1-mediated autophagic vesicle formation and membrane blebbing.
• KEGG Pathway: Viral life cycle - HIV-1 (hsa03250)

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Alzheimer disease	DISF8S70	Strong	Altered Expression	[1]
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Genetic Variation	[2]
Classic galactosemia	DISX7P8M	Strong	Biomarker	[3]
Congenital fibrosis of extraocular muscles	DISE84PU	Strong	Biomarker	[4]
Galactosemia	DIS6V2Q3	Strong	Biomarker	[3]
Hypothyroidism	DISR0H6D	Strong	Biomarker	[5]
Lung cancer	DISCM4YA	Strong	Biomarker	[6]
Lung carcinoma	DISTR26C	Strong	Biomarker	[6]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[7]
Neoplasm	DISZKGEW	Strong	Posttranslational Modification	[8]
Parkinson disease	DISQVHKL	Strong	Altered Expression	[9]
Peripheral neuropathy	DIS7KN5G	Strong	Biomarker	[10]
Periventricular nodular heterotopia 9	DISWKLN1	Strong	Autosomal dominant	[11]
Proximal spinal muscular atrophy	DIS0R70E	Strong	Genetic Variation	[12]
Schizophrenia	DISSRV2N	Strong	Biomarker	[13]
Spinal muscular atrophy	DISTLKOB	Strong	Biomarker	[14]
Chronic obstructive pulmonary disease	DISQCIRF	moderate	Altered Expression	[8]
Intellectual disability	DISMBNXP	moderate	Genetic Variation	[15]
Lung neoplasm	DISVARNB	moderate	Biomarker	[8]
Neuroblastoma	DISVZBI4	moderate	Biomarker	[16]
Periventricular nodular heterotopia	DISU3ZRI	Supportive	Autosomal dominant	[11]
Nervous system disease	DISJ7GGT	Disputed	Biomarker	[17]
Adult glioblastoma	DISVP4LU	Limited	Biomarker	[18]
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Biomarker	[19]
Coronary heart disease	DIS5OIP1	Limited	Biomarker	[20]
Glioblastoma multiforme	DISK8246	Limited	Biomarker	[18]
Glioma	DIS5RPEH	Limited	Altered Expression	[21]
Nervous system inflammation	DISB3X5A	Limited	Biomarker	[22]
Proliferative vitreoretinopathy	DISZTEK1	Limited	Altered Expression	[23]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Daunorubicin	DMQUSBT	Approved	Microtubule-associated protein 1B (MAP1B) affects the response to substance of Daunorubicin.	[51]

28 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Microtubule-associated protein 1B (MAP1B).	[24]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Microtubule-associated protein 1B (MAP1B).	[25]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Microtubule-associated protein 1B (MAP1B).	[26]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Microtubule-associated protein 1B (MAP1B).	[27]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Microtubule-associated protein 1B (MAP1B).	[28]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Microtubule-associated protein 1B (MAP1B).	[29]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Microtubule-associated protein 1B (MAP1B).	[30]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Microtubule-associated protein 1B (MAP1B).	[31]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Microtubule-associated protein 1B (MAP1B).	[25]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Microtubule-associated protein 1B (MAP1B).	[32]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Microtubule-associated protein 1B (MAP1B).	[33]
Folic acid	DMEMBJC	Approved	Folic acid affects the expression of Microtubule-associated protein 1B (MAP1B).	[34]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Microtubule-associated protein 1B (MAP1B).	[35]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Microtubule-associated protein 1B (MAP1B).	[36]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Microtubule-associated protein 1B (MAP1B).	[37]
Clozapine	DMFC71L	Approved	Clozapine decreases the expression of Microtubule-associated protein 1B (MAP1B).	[38]
Cocaine	DMSOX7I	Approved	Cocaine decreases the expression of Microtubule-associated protein 1B (MAP1B).	[39]
Mifepristone	DMGZQEF	Approved	Mifepristone increases the expression of Microtubule-associated protein 1B (MAP1B).	[40]
Phenytoin	DMNOKBV	Approved	Phenytoin increases the expression of Microtubule-associated protein 1B (MAP1B).	[41]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Microtubule-associated protein 1B (MAP1B).	[30]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Microtubule-associated protein 1B (MAP1B).	[42]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Microtubule-associated protein 1B (MAP1B).	[43]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Microtubule-associated protein 1B (MAP1B).	[45]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of Microtubule-associated protein 1B (MAP1B).	[47]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Microtubule-associated protein 1B (MAP1B).	[48]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Microtubule-associated protein 1B (MAP1B).	[30]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Microtubule-associated protein 1B (MAP1B).	[49]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Microtubule-associated protein 1B (MAP1B).	[50]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Microtubule-associated protein 1B (MAP1B).	[44]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Microtubule-associated protein 1B (MAP1B).	[46]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Microtubule-associated protein 1B (MAP1B).	[46]

References

• [1] Brain site-specific gene expression analysis in Alzheimer's disease patients.Eur J Clin Invest. 2006 Nov;36(11):820-30. doi: 10.1111/j.1365-2362.2006.01722.x.
• [2] MAP1B and NOS1 genes are associated with working memory in youths with attention-deficit/hyperactivity disorder.Eur Arch Psychiatry Clin Neurosci. 2016 Jun;266(4):359-66. doi: 10.1007/s00406-015-0626-9. Epub 2015 Aug 2.
• [3] Coordinated movement, neuromuscular synaptogenesis and trans-synaptic signaling defects in Drosophila galactosemia models.Hum Mol Genet. 2016 Sep 1;25(17):3699-3714. doi: 10.1093/hmg/ddw217. Epub 2016 Jul 27.
• [4] Human CFEOM1 mutations attenuate KIF21A autoinhibition and cause oculomotor axon stalling.Neuron. 2014 Apr 16;82(2):334-49. doi: 10.1016/j.neuron.2014.02.038. Epub 2014 Mar 20.
• [5] Effect of hypothyroidism on the expression of three microtubule-associated proteins (1A, 1B and 2) in developing rat cerebellum.Neuroscience. 1988 Dec;27(3):931-9. doi: 10.1016/0306-4522(88)90196-0.
• [6] Interaction of hnRNP K with MAP 1B-LC1 promotes TGF-1-mediated epithelial to mesenchymal transition in lung cancer cells.BMC Cancer. 2019 Sep 6;19(1):894. doi: 10.1186/s12885-019-6119-x.
• [7] Differentiation of classic medulloblastoma into metastatic large cell medulloblastoma with focal rhabdoid differentiation in the absence of posterior fossa recurrence.Acta Neuropathol. 2005 May;109(5):543-51. doi: 10.1007/s00401-005-0986-8. Epub 2005 Mar 10.
• [8] Epigenetic Repression of CCDC37 and MAP1B Links Chronic Obstructive Pulmonary Disease to Lung Cancer.J Thorac Oncol. 2015 Aug;10(8):1181-8. doi: 10.1097/JTO.0000000000000592.
• [9] Axonal pathology in hPSC-based models of Parkinson's disease results from loss of Nrf2 transcriptional activity at the Map1b gene locus.Proc Natl Acad Sci U S A. 2019 Jul 9;116(28):14280-14289. doi: 10.1073/pnas.1900576116. Epub 2019 Jun 24.
• [10] Nmnat mitigates sensory dysfunction in a Drosophila model of paclitaxel-induced peripheral neuropathy.Dis Model Mech. 2018 Jun 12;11(6):dmm032938. doi: 10.1242/dmm.032938.
• [11] De novo and inherited private variants in MAP1B in periventricular nodular heterotopia. PLoS Genet. 2018 May 8;14(5):e1007281. doi: 10.1371/journal.pgen.1007281. eCollection 2018 May.
• [12] Identification of key recombinants in multiplex SMA families.Genomics. 1994 Jul 1;22(1):219-22. doi: 10.1006/geno.1994.1367.
• [13] Hyperactivation of left inferior parietal lobule and left temporal gyri shortens resting EEG microstate in schizophrenia.Schizophr Res. 2018 Nov;201:204-207. doi: 10.1016/j.schres.2018.06.020. Epub 2018 Jun 18.
• [14] Linkage disequilibrium and haplotype analysis among Polish families with spinal muscular atrophy.Am J Hum Genet. 1995 Jan;56(1):210-5.
• [15] MAP1B related syndrome: Case presentation and review of literature.Am J Med Genet A. 2019 Sep;179(9):1703-1708. doi: 10.1002/ajmg.a.61280. Epub 2019 Jul 17.
• [16] Microtubule-associated protein 1B light chain (MAP1B-LC1) negatively regulates the activity of tumor suppressor p53 in neuroblastoma cells.FEBS Lett. 2008 Aug 20;582(19):2826-32. doi: 10.1016/j.febslet.2008.07.021. Epub 2008 Jul 24.
• [17] Microtubule-associated protein 1B: Novel paraneoplastic biomarker.Ann Neurol. 2017 Feb;81(2):266-277. doi: 10.1002/ana.24872.
• [18] A molecular cascade modulates MAP1B and confers resistance to mTOR inhibition in human glioblastoma.Neuro Oncol. 2018 May 18;20(6):764-775. doi: 10.1093/neuonc/nox215.
• [19] Futsch/MAP1B mRNA is a translational target of TDP-43 and is neuroprotective in a Drosophila model of amyotrophic lateral sclerosis.J Neurosci. 2014 Nov 26;34(48):15962-74. doi: 10.1523/JNEUROSCI.2526-14.2014.
• [20] CDKN2B-AS may indirectly regulate coronary artery disease-associated genes via targeting miR-92a.Gene. 2017 Sep 20;629:101-107. doi: 10.1016/j.gene.2017.07.070. Epub 2017 Jul 29.
• [21] Co-expression of low molecular weight neurofilament protein and glial fibrillary acidic protein in established human glioma cell lines.Am J Pathol. 1993 Mar;142(3):883-92.
• [22] Mice devoid of Tau have increased susceptibility to neuronal damage in myelin oligodendrocyte glycoprotein-induced experimental autoimmune encephalomyelitis.J Neuropathol Exp Neurol. 2012 May;71(5):422-33. doi: 10.1097/NEN.0b013e3182540d2e.
• [23] Expression and upregulation of microtubule-associated protein 1B in cultured retinal pigment epithelial cells.Invest Ophthalmol Vis Sci. 1997 Dec;38(13):2852-6.
• [24] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [25] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [26] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [27] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [28] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [29] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [30] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [31] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [32] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [33] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [34] Folate deficiency in normal human fibroblasts leads to altered expression of genes primarily linked to cell signaling, the cytoskeleton and extracellular matrix. J Nutr Biochem. 2007 Aug;18(8):541-52. doi: 10.1016/j.jnutbio.2006.11.002. Epub 2007 Feb 22.
• [35] Gingival Stromal Cells as an In Vitro Model: Cannabidiol Modulates Genes Linked With Amyotrophic Lateral Sclerosis. J Cell Biochem. 2017 Apr;118(4):819-828. doi: 10.1002/jcb.25757. Epub 2016 Nov 28.
• [36] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [37] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [38] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [39] Transcriptional profiling in the human prefrontal cortex: evidence for two activational states associated with cocaine abuse. Pharmacogenomics J. 2003;3(1):27-40.
• [40] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
• [41] Role of phenytoin in wound healing: microarray analysis of early transcriptional responses in human dermal fibroblasts. Biochem Biophys Res Commun. 2004 Feb 13;314(3):661-6. doi: 10.1016/j.bbrc.2003.12.146.
• [42] Effect of benzo[a]pyrene on proliferation and metastasis of oral squamous cell carcinoma cells: A transcriptome analysis based on RNA-seq. Environ Toxicol. 2022 Nov;37(11):2589-2604. doi: 10.1002/tox.23621. Epub 2022 Jul 23.
• [43] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [44] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [45] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [46] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [47] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [48] Bisphenolic compounds alter gene expression in MCF-7 cells through interaction with estrogen receptor . Toxicol Appl Pharmacol. 2020 Jul 15;399:115030. doi: 10.1016/j.taap.2020.115030. Epub 2020 May 6.
• [49] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [50] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [51] Mapping genes that contribute to daunorubicin-induced cytotoxicity. Cancer Res. 2007 Jun 1;67(11):5425-33. doi: 10.1158/0008-5472.CAN-06-4431.