Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTW3LX8D)

• DOT Name: SLC2A4 regulator (SLC2A4RG)
• Synonyms: GLUT4 enhancer factor; GEF; Huntington disease gene regulatory region-binding protein 1; HDBP-1
• Gene Name: SLC2A4RG
• Related Disease:
  Cerebellar degeneration
  T-cell acute lymphoblastic leukaemia
  Adult glioblastoma
  Advanced cancer
  Amyotrophic lateral sclerosis type 2, juvenile
  Arteriosclerosis
  Atherosclerosis
  Charcot marie tooth disease
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Colorectal neoplasm
  Epilepsy
  Familial adenomatous polyposis
  Glioblastoma multiforme
  Glioma
  Hermansky-Pudlak syndrome
  Lung cancer
  Lung carcinoma
  Mental disorder
  Metastatic malignant neoplasm
  Multiple sclerosis
  Neoplasm
  Neurodevelopmental disorder
  Non-small-cell lung cancer
  Overactive bladder
  Polycystic ovarian syndrome
  Prostate carcinoma
  Retinitis pigmentosa
  Rickettsiosis
  Aarskog-Scott syndrome, X-linked
  Adenocarcinoma
  Castration-resistant prostate carcinoma
  Intellectual disability
  Small lymphocytic lymphoma
  Acute myelogenous leukaemia
  Breast cancer
  Breast carcinoma
  Gastric cancer
  Leukodystrophy
  Melanoma
  Prostate cancer
  Stomach cancer
• UniProt ID: S2A4R_HUMAN
• PDB ID: 7DTA
• Sequence:
  MERPPPRAAGRDPSALRAEAPWLRAEGPGPRAAPVTVPTPPQGSSVGGGFAGLEFARPQE
  SEPRASDLGAPRTWTGAAAGPRTPSAHIPVPAQRATPGKARLDEVMAAAALTSLSTSPLL
  LGAPVAAFSPEPGLEPWKEALVRPPGSYSSSSNSGDWGWDLASDQSSPSTPSPPLPPEAA
  HFLFGEPTLRKRKSPAQVMFQCLWKSCGKVLSTASAMQRHIRLVHLGRQAEPEQSDGEED
  FYYTELDVGVDTLTDGLSSLTPVSPTASMPPAFPRLELPELLEPPALPSPLRPPAPPLPP
  PPVLSTVANPQSCHSDRVYQGCLTPARLEPQPTEVGACPPALSSRIGVTLRKPRGDAKKC
  RKVYGMERRDLWCTACRWKKACQRFLD
• Function: Transcription factor involved in SLC2A4 and HD gene transactivation. Binds to the consensus sequence 5'-GCCGGCG-3'.
• Tissue Specificity: According to PubMed:14630949, expressed in heart, skeletal muscle, liver, kidney and pancreas; undetectable in lung, placenta or brain. According to PubMed:14625278, ubiquitously expressed, with lowest expression in brain and ileum.

Molecular Interaction Atlas (MIA) of This DOT

43 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cerebellar degeneration	DISPBCM3	Definitive	Biomarker	[1]
T-cell acute lymphoblastic leukaemia	DIS17AI2	Definitive	Biomarker	[2]
Adult glioblastoma	DISVP4LU	Strong	Genetic Variation	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Amyotrophic lateral sclerosis type 2, juvenile	DISYFHD8	Strong	Genetic Variation	[5]
Arteriosclerosis	DISK5QGC	Strong	Altered Expression	[6]
Atherosclerosis	DISMN9J3	Strong	Altered Expression	[6]
Charcot marie tooth disease	DIS3BT2L	Strong	Genetic Variation	[7]
Colon cancer	DISVC52G	Strong	Genetic Variation	[8]
Colon carcinoma	DISJYKUO	Strong	Genetic Variation	[8]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[9]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[10]
Epilepsy	DISBB28L	Strong	Genetic Variation	[11]
Familial adenomatous polyposis	DISW53RE	Strong	Altered Expression	[10]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[3]
Glioma	DIS5RPEH	Strong	Biomarker	[12]
Hermansky-Pudlak syndrome	DISCY0HQ	Strong	Biomarker	[13]
Lung cancer	DISCM4YA	Strong	Biomarker	[14]
Lung carcinoma	DISTR26C	Strong	Biomarker	[14]
Mental disorder	DIS3J5R8	Strong	Biomarker	[15]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[16]
Multiple sclerosis	DISB2WZI	Strong	Altered Expression	[17]
Neoplasm	DISZKGEW	Strong	Biomarker	[12]
Neurodevelopmental disorder	DIS372XH	Strong	Biomarker	[18]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[19]
Overactive bladder	DISQR5TD	Strong	Genetic Variation	[20]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[21]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[22]
Retinitis pigmentosa	DISCGPY8	Strong	Genetic Variation	[23]
Rickettsiosis	DIS4GUSE	Strong	Biomarker	[24]
Aarskog-Scott syndrome, X-linked	DISNHV62	moderate	Genetic Variation	[25]
Adenocarcinoma	DIS3IHTY	moderate	Altered Expression	[26]
Castration-resistant prostate carcinoma	DISVGAE6	moderate	Altered Expression	[27]
Intellectual disability	DISMBNXP	moderate	Biomarker	[28]
Small lymphocytic lymphoma	DIS30POX	moderate	Altered Expression	[29]
Acute myelogenous leukaemia	DISCSPTN	Limited	Biomarker	[30]
Breast cancer	DIS7DPX1	Limited	Altered Expression	[31]
Breast carcinoma	DIS2UE88	Limited	Altered Expression	[31]
Gastric cancer	DISXGOUK	Limited	Biomarker	[32]
Leukodystrophy	DISVY1TT	Limited	Genetic Variation	[33]
Melanoma	DIS1RRCY	Limited	Altered Expression	[34]
Prostate cancer	DISF190Y	Limited	Altered Expression	[27]
Stomach cancer	DISKIJSX	Limited	Biomarker	[32]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of SLC2A4 regulator (SLC2A4RG).	[35]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of SLC2A4 regulator (SLC2A4RG).	[36]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of SLC2A4 regulator (SLC2A4RG).	[37]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of SLC2A4 regulator (SLC2A4RG).	[38]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of SLC2A4 regulator (SLC2A4RG).	[39]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of SLC2A4 regulator (SLC2A4RG).	[40]
Menadione	DMSJDTY	Approved	Menadione affects the expression of SLC2A4 regulator (SLC2A4RG).	[40]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of SLC2A4 regulator (SLC2A4RG).	[41]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of SLC2A4 regulator (SLC2A4RG).	[42]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of SLC2A4 regulator (SLC2A4RG).	[36]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of SLC2A4 regulator (SLC2A4RG).	[43]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of SLC2A4 regulator (SLC2A4RG).	[44]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of SLC2A4 regulator (SLC2A4RG).	[45]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of SLC2A4 regulator (SLC2A4RG).	[46]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of SLC2A4 regulator (SLC2A4RG).	[47]

References

• [1] An autosomal dominant cerebellar ataxia linked to chromosome 16q22.1 is associated with a single-nucleotide substitution in the 5' untranslated region of the gene encoding a protein with spectrin repeat and Rho guanine-nucleotide exchange-factor domains.Am J Hum Genet. 2005 Aug;77(2):280-96. doi: 10.1086/432518. Epub 2005 Jul 6.
• [2] Vav1: Friend and Foe of Cancer.Trends Cell Biol. 2017 Dec;27(12):879-880. doi: 10.1016/j.tcb.2017.10.004. Epub 2017 Oct 30.
• [3] Whole exome-wide association study identifies a missense variant in SLC2A4RG associated with glioblastoma risk.Am J Cancer Res. 2017 Sep 1;7(9):1937-1947. eCollection 2017.
• [4] Dissociation mechanism of GDP from Cdc42 via DOCK9 revealed by molecular dynamics simulations.Proteins. 2019 Jun;87(6):433-442. doi: 10.1002/prot.25665. Epub 2019 Feb 15.
• [5] Single-nucleotide polymorphisms in uncoding regions of ALS2 gene of Japanese patients with autosomal-recessive amyotrophic lateral sclerosis.Neurol Res. 2003 Jul;25(5):505-9. doi: 10.1179/016164103101201733.
• [6] Computational identification of potential transcriptional regulators of TGF-1 in human atherosclerotic arteries.Genomics. 2014 May-Jun;103(5-6):357-70. doi: 10.1016/j.ygeno.2014.05.001. Epub 2014 May 10.
• [7] Mutations in FGD4 encoding the Rho GDP/GTP exchange factor FRABIN cause autosomal recessive Charcot-Marie-Tooth type 4H.Am J Hum Genet. 2007 Jul;81(1):1-16. doi: 10.1086/518428. Epub 2007 May 15.
• [8] Gef gene therapy enhances the therapeutic efficacy of cytotoxics in colon cancer cells.Biomed Pharmacother. 2012 Oct;66(7):563-7. doi: 10.1016/j.biopha.2012.05.004. Epub 2012 Jun 19.
• [9] ROCK2 inhibition triggers the collective invasion of colorectal adenocarcinomas.EMBO J. 2019 Jul 15;38(14):e99299. doi: 10.15252/embj.201899299. Epub 2019 Jun 18.
• [10] Crystal structure of the rac activator, Asef, reveals its autoinhibitory mechanism.J Biol Chem. 2007 Feb 16;282(7):4238-4242. doi: 10.1074/jbc.C600234200. Epub 2006 Dec 26.
• [11] Loss-of-function mutation of collybistin is responsible for X-linked mental retardation associated with epilepsy.J Hum Genet. 2011 Aug;56(8):561-5. doi: 10.1038/jhg.2011.58. Epub 2011 Jun 2.
• [12] Shuttling SLC2A4RG is regulated by 14-3-3 to modulate cell survival via caspase-3 and caspase-6 in human glioma.EBioMedicine. 2019 Feb;40:163-175. doi: 10.1016/j.ebiom.2019.01.030. Epub 2019 Jan 25.
• [13] The BLOC-3 subunit HPS4 is required for activation of Rab32/38 GTPases in melanogenesis, but its Rab9 activity is dispensable for melanogenesis.J Biol Chem. 2019 Apr 26;294(17):6912-6922. doi: 10.1074/jbc.RA119.007345. Epub 2019 Mar 5.
• [14] Vimentin regulates lung cancer cell adhesion through a VAV2-Rac1 pathway to control focal adhesion kinase activity.Oncogene. 2015 Apr 9;34(15):1979-90. doi: 10.1038/onc.2014.123. Epub 2014 May 26.
• [15] Synaptic GAP and GEF Complexes Cluster Proteins Essential for GTP Signaling.Sci Rep. 2017 Jul 13;7(1):5272. doi: 10.1038/s41598-017-05588-3.
• [16] RABEX-5 plays an oncogenic role in breast cancer by activating MMP-9 pathway.J Exp Clin Cancer Res. 2013 Aug 13;32(1):52. doi: 10.1186/1756-9966-32-52.
• [17] LRCH1 interferes with DOCK8-Cdc42-induced T cell migration and ameliorates experimental autoimmune encephalomyelitis.J Exp Med. 2017 Jan;214(1):209-226. doi: 10.1084/jem.20160068.
• [18] Distinct functions of Trio GEF domains in axon outgrowth of cerebellar granule neurons.J Genet Genomics. 2019 Feb;46(2):87-96. doi: 10.1016/j.jgg.2019.02.003. Epub 2019 Feb 23.
• [19] Inhibition of RAC1-GEF DOCK3 by miR-512-3p contributes to suppression of metastasis in non-small cell lung cancer.Int J Biochem Cell Biol. 2015 Apr;61:103-14. doi: 10.1016/j.biocel.2015.02.005. Epub 2015 Feb 14.
• [20] Relation of ADRB3, GEF, ROCK2 gene polymorphisms to clinical findings in overactive bladder.World J Urol. 2020 Oct;38(10):2571-2575. doi: 10.1007/s00345-019-03046-5. Epub 2019 Dec 4.
• [21] Polymorphism in postinsulin receptor signaling pathway is not associated with polycystic ovary syndrome.Fertil Steril. 2008 Dec;90(6):2298-303. doi: 10.1016/j.fertnstert.2007.10.079. Epub 2008 Feb 4.
• [22] Vav3, a Rho GTPase guanine nucleotide exchange factor, increases during progression to androgen independence in prostate cancer cells and potentiates androgen receptor transcriptional activity.Mol Endocrinol. 2006 May;20(5):1061-72. doi: 10.1210/me.2005-0346. Epub 2005 Dec 29.
• [23] Interaction of retinitis pigmentosa GTPase regulator (RPGR) with RAB8A GTPase: implications for cilia dysfunction and photoreceptor degeneration.Hum Mol Genet. 2010 Sep 15;19(18):3591-8. doi: 10.1093/hmg/ddq275. Epub 2010 Jul 14.
• [24] Which Way In? The RalF Arf-GEF Orchestrates Rickettsia Host Cell Invasion.PLoS Pathog. 2015 Aug 20;11(8):e1005115. doi: 10.1371/journal.ppat.1005115. eCollection 2015 Aug.
• [25] Proline-rich domain plays a crucial role in extracellular stimuli-responsive translocation of a Cdc42 guanine nucleotide exchange factor, FGD1.Biol Pharm Bull. 2010;33(1):35-9. doi: 10.1248/bpb.33.35.
• [26] Ectopic expression of VAV1 reveals an unexpected role in pancreatic cancer tumorigenesis.Cancer Cell. 2005 Jan;7(1):39-49. doi: 10.1016/j.ccr.2004.11.024.
• [27] A novel nuclear role for the Vav3 nucleotide exchange factor in androgen receptor coactivation in prostate cancer.Oncogene. 2012 Feb 9;31(6):716-27. doi: 10.1038/onc.2011.273. Epub 2011 Jul 18.
• [28] Collybistin binds and inhibits mTORC1 signaling: a potential novel mechanism contributing to intellectual disability and autism.Eur J Hum Genet. 2016 Jan;24(1):59-65. doi: 10.1038/ejhg.2015.69. Epub 2015 Apr 22.
• [29] Amplification of B cell receptor-Erk signaling by Rasgrf-1 overexpression in chronic lymphocytic leukemia.Leuk Lymphoma. 2014 Dec;55(12):2907-16. doi: 10.3109/10428194.2014.898759. Epub 2014 Apr 2.
• [30] Identification of a gene at 11q23 encoding a guanine nucleotide exchange factor: evidence for its fusion with MLL in acute myeloid leukemia.Proc Natl Acad Sci U S A. 2000 Feb 29;97(5):2145-50. doi: 10.1073/pnas.040569197.
• [31] P-Rex1 is dispensable for Erk activation and mitogenesis in breast cancer.Oncotarget. 2018 Jun 19;9(47):28612-28624. doi: 10.18632/oncotarget.25584. eCollection 2018 Jun 19.
• [32] miR-148b-3p inhibits gastric cancer metastasis by inhibiting the Dock6/Rac1/Cdc42 axis.J Exp Clin Cancer Res. 2018 Mar 27;37(1):71. doi: 10.1186/s13046-018-0729-z.
• [33] Evaluation of the endoplasmic reticulum-stress response in eIF2B-mutated lymphocytes and lymphoblasts from CACH/VWM patients.BMC Neurol. 2010 Oct 19;10:94. doi: 10.1186/1471-2377-10-94.
• [34] Truncating PREX2 mutations activate its GEF activity and alter gene expression regulation in NRAS-mutant melanoma.Proc Natl Acad Sci U S A. 2016 Mar 1;113(9):E1296-305. doi: 10.1073/pnas.1513801113. Epub 2016 Feb 16.
• [35] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [36] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [37] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [38] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [39] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [40] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [41] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [42] Induction of class II major histocompatibility complex expression in human multiple myeloma cells by retinoid. Haematologica. 2007 Jan;92(1):115-20.
• [43] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [44] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [45] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [46] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [47] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.