Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWJKUHQ)

DOT Name Glutathione hydrolase light chain 1 (GGTLC1)
Synonyms Gamma-glutamyltransferase light chain 1; Gamma-glutamyltransferase-like activity 4; Gamma-glutamyltransferase-like protein 6
Gene Name GGTLC1
Related Disease
Peptic ulcer ( )
Arteriosclerosis ( )
Arthrogryposis, renal dysfunction, and cholestasis 1 ( )
Arthrogryposis-renal dysfunction-cholestasis syndrome ( )
Atherosclerosis ( )
Atrial fibrillation ( )
Benign recurrent intrahepatic cholestasis ( )
Cholangitis ( )
Cholelithiasis ( )
Chronic hepatitis B virus infection ( )
Congestive heart failure ( )
Fatty liver disease ( )
Hepatitis ( )
Hepatitis A virus infection ( )
Hepatocellular carcinoma ( )
Inflammatory bowel disease ( )
Intrahepatic cholestasis ( )
Leukopenia ( )
Liver cancer ( )
Liver cirrhosis ( )
Neoplasm ( )
Non-alcoholic fatty liver disease ( )
Non-insulin dependent diabetes ( )
Obesity ( )
Obstructive jaundice ( )
Primary biliary cholangitis ( )
Progressive familial intrahepatic cholestasis ( )
Progressive familial intrahepatic cholestasis type 1 ( )
Stroke ( )
Thrombocytopenia ( )
Type-1/2 diabetes ( )
Vibrio cholerae infection ( )
Adrenoleukodystrophy ( )
Gastric cancer ( )
Keratoconus ( )
Osteoarthritis ( )
Stomach cancer ( )
Advanced cancer ( )
Asthma ( )
Cholestasis ( )
Coronary heart disease ( )
High blood pressure ( )
Intrahepatic cholestasis of pregnancy ( )
Nasopharyngeal carcinoma ( )
Non-alcoholic steatohepatitis ( )
UniProt ID
GGTL1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01019
Sequence
MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYF
GSKVRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQ
VRMVVGAAGGTQITMATALAIIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVT
AALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Peptic ulcer DISL8XZI Definitive Biomarker [1]
Arteriosclerosis DISK5QGC Strong Biomarker [2]
Arthrogryposis, renal dysfunction, and cholestasis 1 DISRS2RG Strong Altered Expression [3]
Arthrogryposis-renal dysfunction-cholestasis syndrome DISRQJH4 Strong Altered Expression [3]
Atherosclerosis DISMN9J3 Strong Biomarker [2]
Atrial fibrillation DIS15W6U Strong Genetic Variation [4]
Benign recurrent intrahepatic cholestasis DIS7BFN7 Strong Altered Expression [5]
Cholangitis DIS9U3YN Strong Biomarker [6]
Cholelithiasis DISERLZB Strong Biomarker [7]
Chronic hepatitis B virus infection DISHL4NT Strong Biomarker [8]
Congestive heart failure DIS32MEA Strong Altered Expression [9]
Fatty liver disease DIS485QZ Strong Biomarker [10]
Hepatitis DISXXX35 Strong Biomarker [11]
Hepatitis A virus infection DISUMFQV Strong Biomarker [11]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [12]
Inflammatory bowel disease DISGN23E Strong Altered Expression [13]
Intrahepatic cholestasis DISHITDZ Strong Biomarker [14]
Leukopenia DISJMBMM Strong Biomarker [15]
Liver cancer DISDE4BI Strong Biomarker [16]
Liver cirrhosis DIS4G1GX Strong Biomarker [17]
Neoplasm DISZKGEW Strong Biomarker [18]
Non-alcoholic fatty liver disease DISDG1NL Strong Biomarker [19]
Non-insulin dependent diabetes DISK1O5Z Strong Biomarker [20]
Obesity DIS47Y1K Strong Genetic Variation [21]
Obstructive jaundice DIS2FDOT Strong Biomarker [22]
Primary biliary cholangitis DIS43E0O Strong Altered Expression [23]
Progressive familial intrahepatic cholestasis DIS3J8HT Strong Altered Expression [24]
Progressive familial intrahepatic cholestasis type 1 DISU0AJE Strong Altered Expression [24]
Stroke DISX6UHX Strong Biomarker [21]
Thrombocytopenia DISU61YW Strong Altered Expression [25]
Type-1/2 diabetes DISIUHAP Strong Biomarker [26]
Vibrio cholerae infection DISW7E3U Strong Biomarker [27]
Adrenoleukodystrophy DISTUD1F moderate Genetic Variation [28]
Gastric cancer DISXGOUK moderate Biomarker [29]
Keratoconus DISOONXH moderate Biomarker [30]
Osteoarthritis DIS05URM moderate Biomarker [31]
Stomach cancer DISKIJSX moderate Biomarker [29]
Advanced cancer DISAT1Z9 Limited Altered Expression [32]
Asthma DISW9QNS Limited Genetic Variation [33]
Cholestasis DISDJJWE Limited Biomarker [11]
Coronary heart disease DIS5OIP1 Limited Genetic Variation [34]
High blood pressure DISY2OHH Limited Biomarker [2]
Intrahepatic cholestasis of pregnancy DISMHS5F Limited Biomarker [35]
Nasopharyngeal carcinoma DISAOTQ0 Limited Biomarker [36]
Non-alcoholic steatohepatitis DIST4788 Limited Altered Expression [37]
------------------------------------------------------------------------------------
⏷ Show the Full List of 45 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Glutathione hydrolase light chain 1 (GGTLC1). [38]
------------------------------------------------------------------------------------
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Glutathione hydrolase light chain 1 (GGTLC1). [39]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Glutathione hydrolase light chain 1 (GGTLC1). [40]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Glutathione hydrolase light chain 1 (GGTLC1). [41]
Testosterone DM7HUNW Approved Testosterone increases the expression of Glutathione hydrolase light chain 1 (GGTLC1). [41]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Glutathione hydrolase light chain 1 (GGTLC1). [42]
------------------------------------------------------------------------------------

References

1 Helicobacter pylori gamma-glutamyl transpeptidase is a pathogenic factor in the development of peptic ulcer disease.Gastroenterology. 2010 Aug;139(2):564-73. doi: 10.1053/j.gastro.2010.03.050. Epub 2010 Mar 27.
2 Gamma-glutamyl transpeptidase (-GTP) has an ambivalent association with hypertension and atherosclerosis among elderly Japanese men: a cross-sectional study.Environ Health Prev Med. 2019 Nov 30;24(1):69. doi: 10.1186/s12199-019-0828-2.
3 ARC syndrome with high GGT cholestasis caused by VPS33B mutations.World J Gastroenterol. 2014 Apr 28;20(16):4830-4. doi: 10.3748/wjg.v20.i16.4830.
4 Direct bilirubin level is an independent risk factor for atrial fibrillation in thyrotoxic patients receiving radioactive iodine therapy.Nucl Med Commun. 2019 Dec;40(12):1289-1294. doi: 10.1097/MNM.0000000000001107.
5 Molecular Genetic Dissection and Neonatal/Infantile Intrahepatic Cholestasis Using Targeted Next-Generation Sequencing.J Pediatr. 2016 Apr;171:171-7.e1-4. doi: 10.1016/j.jpeds.2016.01.006. Epub 2016 Feb 5.
6 Imaging and clinicopathological features of nivolumab-related cholangitis in patients with non-small cell lung cancer.Invest New Drugs. 2017 Aug;35(4):529-536. doi: 10.1007/s10637-017-0453-0. Epub 2017 Mar 20.
7 Linkage between a new splicing site mutation in the MDR3 alias ABCB4 gene and intrahepatic cholestasis of pregnancy.Hepatology. 2007 Jan;45(1):150-8. doi: 10.1002/hep.21500.
8 Serum NOX2 as a new biomarker candidate for HBV-related disorders.Am J Transl Res. 2018 Aug 15;10(8):2350-2361. eCollection 2018.
9 Functional validation of novel MKS3/TMEM67 mutations in COACH syndrome.Sci Rep. 2017 Aug 31;7(1):10222. doi: 10.1038/s41598-017-10652-z.
10 A community-based study on the application of fatty liver index in screening subjects with nonalcoholic fatty liver disease.J Formos Med Assoc. 2020 Jan;119(1 Pt 1):173-181. doi: 10.1016/j.jfma.2019.03.016. Epub 2019 Apr 11.
11 Hepatic Lesions Associated With McCune Albright Syndrome.J Pediatr Gastroenterol Nutr. 2019 Apr;68(4):e54-e57. doi: 10.1097/MPG.0000000000002266.
12 Direct-acting antiviral agents do not increase the incidence of hepatocellular carcinoma development: a prospective, multicenter study.Hepatol Int. 2019 May;13(3):293-301. doi: 10.1007/s12072-019-09939-2. Epub 2019 Feb 28.
13 Unique Inflammatory Bowel Disease Phenotype of Pediatric Primary Sclerosing Cholangitis: A Single-Center Study.J Pediatr Gastroenterol Nutr. 2017 Oct;65(4):404-409. doi: 10.1097/MPG.0000000000001531.
14 Clinical and ABCB11 profiles in Korean infants with progressive familial intrahepatic cholestasis.World J Gastroenterol. 2016 May 28;22(20):4901-7. doi: 10.3748/wjg.v22.i20.4901.
15 Asymptomatic hepatitis G virus infection in blood donors.Transfusion. 1997 Nov-Dec;37(11-12):1200-4. doi: 10.1046/j.1537-2995.1997.37111298088052.x.
16 Ultrasensitive detection of glutathione based on liquid crystals in the presence of -glutamyl transpeptidase.Anal Chim Acta. 2018 Dec 21;1040:187-195. doi: 10.1016/j.aca.2018.08.029. Epub 2018 Aug 15.
17 Are non-invasive fibrosis markers for chronic hepatitis B reliable in sub-Saharan Africa?.Liver Int. 2017 Oct;37(10):1461-1467. doi: 10.1111/liv.13393. Epub 2017 Mar 23.
18 Anticancer effect of Limonin against benzo(a)pyrene-induced lung carcinogenesis in Swiss albino mice and the inhibition of A549 cell proliferation through apoptotic pathway.J Biochem Mol Toxicol. 2019 Dec;33(12):e22374. doi: 10.1002/jbt.22374. Epub 2019 Nov 8.
19 Haptoglobin 2 Allele is Associated With Histologic Response to Vitamin E in Subjects With Nonalcoholic Steatohepatitis.J Clin Gastroenterol. 2019 Nov/Dec;53(10):750-758. doi: 10.1097/MCG.0000000000001142.
20 Brain education-based meditation for patients with hypertension and/or type 2 diabetes: A pilot randomized controlled trial.Medicine (Baltimore). 2019 May;98(19):e15574. doi: 10.1097/MD.0000000000015574.
21 The -1438A/G polymorphism in the 5-hydroxytryptamine receptor 2A gene is related to hyperuricemia, increased gamma-glutamyl transpeptidase and decreased high-density lipoprotein cholesterol level in the Japanese population: a prospective cohort study over 5 years.Int J Mol Med. 2006 Jan;17(1):77-82.
22 Not only Alagille syndrome. Syndromic paucity of interlobular bile ducts secondary to HNF1 deficiency: a case report and literature review.Ital J Pediatr. 2019 Feb 21;45(1):27. doi: 10.1186/s13052-019-0617-y.
23 Clinical significance of the Scheuer histological staging system for primary biliary cholangitis in Japanese patients.Eur J Gastroenterol Hepatol. 2017 Jan;29(1):23-30. doi: 10.1097/MEG.0000000000000765.
24 Comorbidity between progressive familial intrahepatic cholestasis and atopic dermatitis in a 19-month-old child.BMJ Case Rep. 2019 Oct 18;12(10):e230152. doi: 10.1136/bcr-2019-230152.
25 Blood parameters in fetuses infected with cytomegalovirus according to the severity of brain damage and trimester of pregnancy at cordocentesis.J Clin Virol. 2019 Oct;119:37-43. doi: 10.1016/j.jcv.2019.08.008. Epub 2019 Aug 20.
26 Relationships between plasma lactate, plasma alanine, genetic variations in lactate transporters and type 2 diabetes in the Japanese population.Drug Metab Pharmacokinet. 2020 Feb;35(1):131-138. doi: 10.1016/j.dmpk.2019.10.001. Epub 2019 Oct 17.
27 A novel design of a multi-antigenic, multistage and multi-epitope vaccine against Helicobacter pylori: An in silico approach.Infect Genet Evol. 2017 Apr;49:309-317. doi: 10.1016/j.meegid.2017.02.007. Epub 2017 Feb 7.
28 Single-nucleotide rs738409 polymorphisms in the PNPLA3 gene are strongly associated with alcoholic liver disease in Han Chinese males.Hepatol Int. 2018 Sep;12(5):429-437. doi: 10.1007/s12072-018-9889-3. Epub 2018 Aug 21.
29 Tumor and serum gamma-glutamyl transpeptidase, new prognostic and molecular interpretation of an old biomarker in gastric cancer.Oncotarget. 2017 May 30;8(22):36171-36184. doi: 10.18632/oncotarget.15609.
30 Tear fluid small molecular antioxidants profiling shows lowered glutathione in keratoconus.Exp Eye Res. 2012 Oct;103:41-6. doi: 10.1016/j.exer.2012.07.010. Epub 2012 Aug 10.
31 Pre-administration of rats with Helicobacter pylori -glutamyl-transpeptidase alleviates osteoarthritis.Biotechnol Lett. 2018 Mar;40(3):521-526. doi: 10.1007/s10529-017-2495-y. Epub 2017 Dec 21.
32 Prognostic significance of preoperative albumin-to-globulin ratio in patients with cholangiocarcinoma.Curr Res Transl Med. 2017 Apr-Jun;65(2):83-87. doi: 10.1016/j.retram.2017.06.002. Epub 2017 Jul 3.
33 Effective treatment of allergic airway inflammation with Helicobacter pylori immunomodulators requires BATF3-dependent dendritic cells and IL-10.Proc Natl Acad Sci U S A. 2014 Aug 12;111(32):11810-5. doi: 10.1073/pnas.1410579111. Epub 2014 Jul 29.
34 Monocyte chemoattractant protein-1 gene (MCP-1) polymorphisms are associated with risk of premature coronary artery disease in Mexican patients from the Genetics of Atherosclerotic Disease (GEA) study.Immunol Lett. 2015 Oct;167(2):125-30. doi: 10.1016/j.imlet.2015.08.003. Epub 2015 Aug 12.
35 A new splicing site mutation of the ABCB4 gene in intrahepatic cholestasis of pregnancy with raised serum gamma-GT.Dig Liver Dis. 2009 Sep;41(9):671-5. doi: 10.1016/j.dld.2008.12.101. Epub 2009 Mar 3.
36 High pretreatment serum gamma-glutamyl transpeptidase predicts an inferior outcome in nasopharyngeal carcinoma.Oncotarget. 2017 Jun 28;8(40):67651-67662. doi: 10.18632/oncotarget.18798. eCollection 2017 Sep 15.
37 Dulaglutide decreases plasma aminotransferases in people with Type 2 diabetes in a pattern consistent with liver fat reduction: a post hoc analysis of the AWARD programme.Diabet Med. 2018 Oct;35(10):1434-1439. doi: 10.1111/dme.13697. Epub 2018 Jun 22.
38 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
39 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
40 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
41 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
42 Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.