Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTX9SBJG)

DOT Name Beta-catenin-interacting protein 1 (CTNNBIP1)
Synonyms Inhibitor of beta-catenin and Tcf-4
Gene Name CTNNBIP1
Related Disease
Thyroid gland papillary carcinoma ( )
Breast cancer ( )
Bulimia nervosa ( )
Colorectal neoplasm ( )
Cytomegalovirus infection ( )
Desmoid tumour ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Epithelial ovarian cancer ( )
Epstein barr virus infection ( )
Gastric adenocarcinoma ( )
Gastric neoplasm ( )
Glioma ( )
Hepatocellular carcinoma ( )
Lung adenocarcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Medulloblastoma ( )
Melanocytic nevus ( )
Melanoma ( )
Metastatic malignant neoplasm ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Breast carcinoma ( )
Neuroblastoma ( )
Adenocarcinoma ( )
Advanced cancer ( )
Colorectal carcinoma ( )
Endometrium neoplasm ( )
Familial adenomatous polyposis ( )
UniProt ID
CNBP1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1LUJ; 1M1E; 1T08
Pfam ID
PF06384
Sequence
MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSI
DQGAEDVVMAFSRSETEDRRQ
Function Prevents the interaction between CTNNB1 and TCF family members, and acts as a negative regulator of the Wnt signaling pathway.
KEGG Pathway
Wnt sig.ling pathway (hsa04310 )
Reactome Pathway
Deactivation of the beta-catenin transactivating complex (R-HSA-3769402 )

Molecular Interaction Atlas (MIA) of This DOT

30 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Thyroid gland papillary carcinoma DIS48YMM Definitive Altered Expression [1]
Breast cancer DIS7DPX1 Strong Biomarker [2]
Bulimia nervosa DISGQ59Y Strong Biomarker [3]
Colorectal neoplasm DISR1UCN Strong Altered Expression [4]
Cytomegalovirus infection DISCEMGC Strong Altered Expression [5]
Desmoid tumour DISGX357 Strong Genetic Variation [6]
Endometrial cancer DISW0LMR Strong Biomarker [7]
Endometrial carcinoma DISXR5CY Strong Biomarker [7]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [8]
Epstein barr virus infection DISOO0WT Strong Altered Expression [5]
Gastric adenocarcinoma DISWWLTC Strong Biomarker [5]
Gastric neoplasm DISOKN4Y Strong Altered Expression [5]
Glioma DIS5RPEH Strong Biomarker [9]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [10]
Lung adenocarcinoma DISD51WR Strong Biomarker [11]
Lung cancer DISCM4YA Strong Altered Expression [12]
Lung carcinoma DISTR26C Strong Altered Expression [12]
Medulloblastoma DISZD2ZL Strong Biomarker [13]
Melanocytic nevus DISYS32D Strong Altered Expression [14]
Melanoma DIS1RRCY Strong Biomarker [14]
Metastatic malignant neoplasm DIS86UK6 Strong Genetic Variation [14]
Ovarian cancer DISZJHAP Strong Biomarker [8]
Ovarian neoplasm DISEAFTY Strong Biomarker [8]
Breast carcinoma DIS2UE88 moderate Biomarker [2]
Neuroblastoma DISVZBI4 moderate Genetic Variation [15]
Adenocarcinoma DIS3IHTY Disputed Altered Expression [16]
Advanced cancer DISAT1Z9 Limited Biomarker [5]
Colorectal carcinoma DIS5PYL0 Limited Altered Expression [17]
Endometrium neoplasm DIS6OS2L Limited Altered Expression [18]
Familial adenomatous polyposis DISW53RE Limited Biomarker [19]
------------------------------------------------------------------------------------
⏷ Show the Full List of 30 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Beta-catenin-interacting protein 1 (CTNNBIP1). [20]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Beta-catenin-interacting protein 1 (CTNNBIP1). [21]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Beta-catenin-interacting protein 1 (CTNNBIP1). [22]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Beta-catenin-interacting protein 1 (CTNNBIP1). [23]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Beta-catenin-interacting protein 1 (CTNNBIP1). [24]
Niclosamide DMJAGXQ Approved Niclosamide increases the expression of Beta-catenin-interacting protein 1 (CTNNBIP1). [25]
Cocaine DMSOX7I Approved Cocaine decreases the expression of Beta-catenin-interacting protein 1 (CTNNBIP1). [26]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Beta-catenin-interacting protein 1 (CTNNBIP1). [27]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Beta-catenin-interacting protein 1 (CTNNBIP1). [28]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Beta-catenin-interacting protein 1 (CTNNBIP1). [31]
Paraquat DMR8O3X Investigative Paraquat increases the expression of Beta-catenin-interacting protein 1 (CTNNBIP1). [32]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 increases the phosphorylation of Beta-catenin-interacting protein 1 (CTNNBIP1). [29]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Beta-catenin-interacting protein 1 (CTNNBIP1). [30]
------------------------------------------------------------------------------------

References

1 CircRNA circRNA_102171 promotes papillary thyroid cancer progression through modulating CTNNBIP1-dependent activation of -catenin pathway.J Exp Clin Cancer Res. 2018 Nov 13;37(1):275. doi: 10.1186/s13046-018-0936-7.
2 Frequent inactivation of MCC/CTNNBIP1 and overexpression of phospho-beta-catenin(Y654) are associated with breast carcinoma: Clinical and prognostic significance.Biochim Biophys Acta. 2016 Sep;1862(9):1472-84. doi: 10.1016/j.bbadis.2016.05.009. Epub 2016 May 18.
3 The effects of psychotherapy treatment on outcome in bulimia nervosa: Examining indirect effects through emotion regulation, self-directed behavior, and self-discrepancy within the mediation model.Int J Eat Disord. 2017 Jun;50(6):636-647. doi: 10.1002/eat.22669. Epub 2017 Jan 24.
4 Overexpression of Icat induces G(2) arrest and cell death in tumor cell mutants for adenomatous polyposis coli, beta-catenin, or Axin.Cancer Res. 2002 Jun 1;62(11):3322-6.
5 CTNNBIP1 downregulation is associated with tumor grade and viral infections in gastric adenocarcinoma.J Cell Physiol. 2019 Mar;234(3):2895-2904. doi: 10.1002/jcp.27106. Epub 2018 Aug 4.
6 Correlation between beta-catenin widespread nuclear expression and matrix metalloproteinase-7 overexpression in sporadic desmoid tumors.Hum Pathol. 2008 Dec;39(12):1802-8. doi: 10.1016/j.humpath.2008.05.005. Epub 2008 Aug 19.
7 HE4 transcription- and splice variants-specific expression in endometrial cancer and correlation with patient survival.Int J Mol Sci. 2013 Nov 18;14(11):22655-77. doi: 10.3390/ijms141122655.
8 Mllerian inhibiting substance inhibits an ovarian cancer cell line via -catenin interacting protein deregulation of the Wnt signal pathway.Int J Oncol. 2017 Mar;50(3):1022-1028. doi: 10.3892/ijo.2017.3874. Epub 2017 Feb 13.
9 miR-603 promotes glioma cell growth via Wnt/-catenin pathway by inhibiting WIF1 and CTNNBIP1.Cancer Lett. 2015 Apr 28;360(1):76-86. doi: 10.1016/j.canlet.2015.02.003. Epub 2015 Feb 10.
10 MiR-424-5p reversed epithelial-mesenchymal transition of anchorage-independent HCC cells by directly targeting ICAT and suppressed HCC progression.Sci Rep. 2014 Sep 1;4:6248. doi: 10.1038/srep06248.
11 Targeting the Wnt-Regulatory Protein CTNNBIP1 by microRNA-214 Enhances the Stemness and Self-Renewal of Cancer Stem-Like Cells in Lung Adenocarcinomas.Stem Cells. 2015 Dec;33(12):3423-36. doi: 10.1002/stem.2188. Epub 2015 Sep 26.
12 The Alteration of CTNNBIP1 in Lung Cancer.Int J Mol Sci. 2019 Nov 13;20(22):5684. doi: 10.3390/ijms20225684.
13 Familial medulloblastoma: case report of one family and review of the literature.Neurosurgery. 2002 Jul;51(1):227-33; discussion 233. doi: 10.1097/00006123-200207000-00035.
14 Molecular genetic analysis of malignant melanomas for aberrations of the WNT signaling pathway genes CTNNB1, APC, ICAT and BTRC.Int J Cancer. 2002 Aug 10;100(5):549-56. doi: 10.1002/ijc.10512.
15 Screening for gene mutations in a 500 kb neuroblastoma tumor suppressor candidate region in chromosome 1p; mutation and stage-specific expression in UBE4B/UFD2.Oncogene. 2003 Apr 17;22(15):2343-51. doi: 10.1038/sj.onc.1206324.
16 Clinicopathological and molecular analysis of endometrial carcinoma associated with tamoxifen.Mod Pathol. 2008 Aug;21(8):925-36. doi: 10.1038/modpathol.2008.49. Epub 2008 May 23.
17 Mutation and expression of the beta-catenin-interacting protein ICAT in human colorectal tumors.Jpn J Clin Oncol. 2002 Sep;32(9):358-62. doi: 10.1093/jjco/hyf068.
18 Loss of gamma-Catenin expression in squamous differentiation in endometrial carcinomas.Int J Gynecol Pathol. 2002 Jul;21(3):246-54. doi: 10.1097/00004347-200207000-00007.
19 Identification of ICAT as an APC Inhibitor, Revealing Wnt-Dependent Inhibition of APC-Axin Interaction.Mol Cell. 2018 Oct 4;72(1):37-47.e4. doi: 10.1016/j.molcel.2018.07.040. Epub 2018 Sep 6.
20 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
21 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
22 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
23 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
24 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
25 Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
26 Gene expression in human hippocampus from cocaine abusers identifies genes which regulate extracellular matrix remodeling. PLoS One. 2007 Nov 14;2(11):e1187. doi: 10.1371/journal.pone.0001187.
27 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
28 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
29 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
30 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
31 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
32 Integrated analysis of paraquat-induced microRNAs-mRNAs changes in human neural progenitor cells. Toxicol In Vitro. 2017 Oct;44:196-205. doi: 10.1016/j.tiv.2017.06.010. Epub 2017 Jun 12.