Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYNO8BS)

• DOT Name: Ly6/PLAUR domain-containing protein 4 (LYPD4)
• Gene Name: LYPD4
• Related Disease:
  Bladder cancer
  Cerebrovascular disease
  Pulmonary tuberculosis
  Subarachnoid hemorrhage
  Tuberculosis
  Urinary bladder cancer
  Urinary bladder neoplasm
  Asbestosis
  B-cell lymphoma
  Breast cancer
  Breast carcinoma
  Breast carcinoma in situ
  Cardiovascular disease
  Epithelial ovarian cancer
  Gastric cancer
  Inborn error of metabolism
  Laryngeal disorder
  Long QT syndrome
  Lung cancer
  Lung carcinoma
  Male breast carcinoma
  Malignant neoplasm
  Neoplasm
  Obesity
  Ovarian cancer
  Ovarian neoplasm
  Schizophrenia
  Stomach cancer
  Stroke
  Type-1/2 diabetes
  Urinary tract infection
  Colorectal carcinoma
  Methicillin-resistant staphylococci infection
  Advanced cancer
  Chronic renal failure
  Prostate cancer
  Prostate carcinoma
• UniProt ID: LYPD4_HUMAN
• Pfam ID: PF00021
• Sequence:
  MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLMRNMVCKLQEG
  CEETLVFIETGTARGVVGFKGCSSSSSYPAQISYLVSPPGVSIASYSRVCRSYLCNNLTN
  LEPFVKLKASTPKSITSASCSCPTCVGEHMKDCLPNFVTTNSCPLAASTCYSSTLKFQAG
  FLNTTFLLMGCAREHNQLLADFHHIGSIKVTEVLNILEKSQIVGAASSRQDPAWGVVLGL
  LFAFRD
• Reactome Pathway: Post-translational modification (R-HSA-163125)

Molecular Interaction Atlas (MIA) of This DOT

37 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bladder cancer	DISUHNM0	Definitive	Biomarker	[1]
Cerebrovascular disease	DISAB237	Definitive	Biomarker	[2]
Pulmonary tuberculosis	DIS6FLUM	Definitive	Biomarker	[3]
Subarachnoid hemorrhage	DISI7I8Y	Definitive	Genetic Variation	[4]
Tuberculosis	DIS2YIMD	Definitive	Biomarker	[3]
Urinary bladder cancer	DISDV4T7	Definitive	Biomarker	[1]
Urinary bladder neoplasm	DIS7HACE	Definitive	Biomarker	[1]
Asbestosis	DISO5XCZ	Strong	Biomarker	[5]
B-cell lymphoma	DISIH1YQ	Strong	Genetic Variation	[6]
Breast cancer	DIS7DPX1	Strong	Biomarker	[7]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[7]
Breast carcinoma in situ	DISRN92I	Strong	Biomarker	[7]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[8]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[9]
Gastric cancer	DISXGOUK	Strong	Genetic Variation	[10]
Inborn error of metabolism	DISO5FAY	Strong	Biomarker	[11]
Laryngeal disorder	DISDKUQO	Strong	Biomarker	[9]
Long QT syndrome	DISMKWS3	Strong	Biomarker	[12]
Lung cancer	DISCM4YA	Strong	Biomarker	[13]
Lung carcinoma	DISTR26C	Strong	Biomarker	[13]
Male breast carcinoma	DISUNQ2Q	Strong	Genetic Variation	[10]
Malignant neoplasm	DISS6SNG	Strong	Biomarker	[5]
Neoplasm	DISZKGEW	Strong	Biomarker	[9]
Obesity	DIS47Y1K	Strong	Genetic Variation	[14]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[15]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[15]
Schizophrenia	DISSRV2N	Strong	Biomarker	[16]
Stomach cancer	DISKIJSX	Strong	Genetic Variation	[10]
Stroke	DISX6UHX	Strong	Genetic Variation	[8]
Type-1/2 diabetes	DISIUHAP	Strong	Genetic Variation	[17]
Urinary tract infection	DISMT6UV	Strong	Biomarker	[18]
Colorectal carcinoma	DIS5PYL0	moderate	Biomarker	[13]
Methicillin-resistant staphylococci infection	DIS6DRDZ	moderate	Biomarker	[19]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[5]
Chronic renal failure	DISGG7K6	Limited	Biomarker	[20]
Prostate cancer	DISF190Y	Limited	Genetic Variation	[21]
Prostate carcinoma	DISMJPLE	Limited	Genetic Variation	[21]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Ly6/PLAUR domain-containing protein 4 (LYPD4).	[22]

References

• [1] Lifetime risks of common cancers among retinoblastoma survivors. J Natl Cancer Inst. 2004 Mar 3;96(5):357-63. doi: 10.1093/jnci/djh058.
• [2] Mortality and causes of death in families with the factor V Leiden mutation (resistance to activated protein C).Blood. 1997 Mar 15;89(6):1963-7.
• [3] Correlations between major risk factors and closely related Mycobacterium tuberculosis isolates grouped by three current genotyping procedures: a population-based study in northeast Mexico.Mem Inst Oswaldo Cruz. 2014 Sep;109(6):814-9. doi: 10.1590/0074-0276130550.
• [4] Neuro-endoscopic management of hemorrhagic moyamoya disease in the acute stage: single institute experience.Neurol Res. 2019 Dec;41(12):1097-1103. doi: 10.1080/01616412.2019.1674006. Epub 2019 Oct 12.
• [5] Cumulative asbestos exposure and mortality from asbestos related diseases in a pooled analysis of 21 asbestos cement cohorts in Italy.Environ Health. 2019 Aug 7;18(1):71. doi: 10.1186/s12940-019-0510-6.
• [6] Long-term outcomes among 2-year survivors of autologous hematopoietic cell transplantation for Hodgkin and diffuse large b-cell lymphoma.Cancer. 2018 Feb 15;124(4):816-825. doi: 10.1002/cncr.31114. Epub 2017 Nov 10.
• [7] Cause-specific mortality in women with breast cancer in situ.Int J Cancer. 2017 Jun 1;140(11):2414-2421. doi: 10.1002/ijc.30413. Epub 2016 Sep 19.
• [8] Silica exposure increases the risk of stroke but not myocardial infarction-A retrospective cohort study.PLoS One. 2018 Feb 26;13(2):e0192840. doi: 10.1371/journal.pone.0192840. eCollection 2018.
• [9] Cancer mortality in relatives of women with breast cancer: the OPCS Study. Office of Population Censuses and Surveys.Int J Cancer. 1996 Jan 26;65(3):275-83. doi: 10.1002/(SICI)1097-0215(19960126)65:3<275::AID-IJC1>3.0.CO;2-X.
• [10] Incidence of malignant tumours in relatives of BRCA1 and BRCA2 germline mutation carriers.Eur J Cancer. 1999 Aug;35(8):1248-57. doi: 10.1016/s0959-8049(99)00135-5.
• [11] Epidemiology of mental retardation--a Swedish survey.Brain Dev. 1983;5(5):441-9. doi: 10.1016/s0387-7604(83)80072-2.
• [12] Mortality of inherited arrhythmia syndromes: insight into their natural history.Circ Cardiovasc Genet. 2012 Apr 1;5(2):183-9. doi: 10.1161/CIRCGENETICS.111.961102. Epub 2012 Feb 28.
• [13] Exposure to asbestos and the risk of colorectal cancer mortality: a systematic review and meta-analysis.Occup Environ Med. 2019 Nov;76(11):861-871. doi: 10.1136/oemed-2019-105735. Epub 2019 Oct 8.
• [14] A Genomewide Integrative Analysis of GWAS and eQTLs Data Identifies Multiple Genes and Gene Sets Associated with Obesity.Biomed Res Int. 2018 May 8;2018:3848560. doi: 10.1155/2018/3848560. eCollection 2018.
• [15] Cancer mortality in relatives of women with ovarian cancer: the OPCS Study. Office of Population Censuses and Surveys.Int J Cancer. 1996 Jan 26;65(3):284-94. doi: 10.1002/(SICI)1097-0215(19960126)65:3<284::AID-IJC2>3.0.CO;2-W.
• [16] Integrating genome-wide association study and expression quantitative trait locus study identifies multiple genes and gene sets associated with schizophrenia. Prog Neuropsychopharmacol Biol Psychiatry. 2018 Feb 2;81:50-54. doi: 10.1016/j.pnpbp.2017.10.003. Epub 2017 Oct 9.
• [17] Cardiovascular Risk and Metabolic Syndrome Characteristics in Patients with Nonfunctional Pituitary Macroadenoma.Int J Endocrinol. 2018 Aug 27;2018:2852710. doi: 10.1155/2018/2852710. eCollection 2018.
• [18] YnfA , a SMR family efflux pump is abundant in Escherichia coli isolates from urinary infection.Indian J Med Microbiol. 2015 Jan-Mar;33(1):139-42. doi: 10.4103/0255-0857.148415.
• [19] Coexistence of mupirocin and antiseptic resistance in methicillin-resistant Staphylococcus aureus isolates from Korea.Diagn Microbiol Infect Dis. 2013 Mar;75(3):308-12. doi: 10.1016/j.diagmicrobio.2012.11.025. Epub 2013 Jan 18.
• [20] Danshen can interact with intestinal bacteria from normal and chronic renal failure rats.Biomed Pharmacother. 2019 Jan;109:1758-1771. doi: 10.1016/j.biopha.2018.11.047. Epub 2018 Nov 26.
• [21] Prostate cancer in Germany among migrants from the Former Soviet Union.Glob Health Action. 2012;5:9135. doi: 10.3402/gha.v5i0.9135. Epub 2012 Jan 2.
• [22] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.