Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZNGJGW)

• DOT Name: F-box only protein 8 (FBXO8)
• Synonyms: F-box/SEC7 protein FBS
• Gene Name: FBXO8
• Related Disease:
  Acute lymphocytic leukaemia
  Acute myelogenous leukaemia
  Anthrax
  Arteriosclerosis
  Atherosclerosis
  Breast cancer
  Carcinoma
  Cardiovascular disease
  Gastric cancer
  Glioma
  Glycogen storage disease due to GLUT2 deficiency
  Hepatocellular carcinoma
  Hyperglycemia
  Lung cancer
  Lung carcinoma
  Neoplasm
  Non-small-cell lung cancer
  Osteoarthritis
  Parkinson disease
  Pituitary dwarfism
  Polycystic ovarian syndrome
  Split hand-foot malformation 3
  Stomach cancer
  Breast carcinoma
  Diabetic retinopathy
  Advanced cancer
  Asthma
  Colorectal carcinoma
  Prostate cancer
  Prostate carcinoma
  Type-1/2 diabetes
• UniProt ID: FBX8_HUMAN
• Pfam ID: PF12937 ; PF01369
• Sequence:
  MGQGLWRVVRNQQLQQEGYSEQGYLTREQSRRMAASNISNTNHRKQVQGGIDIYHLLKAR
  KSKEQEGFINLEMLPPELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCS
  IYNKNPPLGFSFRKLYMQLDEGSLTFNANPDEGVNYFMSKGILDDSPKEIAKFIFCTRTL
  NWKKLRIYLDERRDVLDDLVTLHNFRNQFLPNALREFFRHIHAPEERGEYLETLITKFSH
  RFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVKNKMSKREFIRNTRRAAQNIS
  EDFVGHLYDNIYLIGHVAA
• Function: May promote guanine-nucleotide exchange on an ARF. Promotes the activation of ARF through replacement of GDP with GTP (Potential).

Molecular Interaction Atlas (MIA) of This DOT

31 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[1]
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[2]
Anthrax	DISFPT78	Strong	Biomarker	[3]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[4]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[4]
Breast cancer	DIS7DPX1	Strong	Biomarker	[5]
Carcinoma	DISH9F1N	Strong	Biomarker	[6]
Cardiovascular disease	DIS2IQDX	Strong	Altered Expression	[7]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[8]
Glioma	DIS5RPEH	Strong	Biomarker	[9]
Glycogen storage disease due to GLUT2 deficiency	DISXRSZ1	Strong	Biomarker	[10]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[11]
Hyperglycemia	DIS0BZB5	Strong	Genetic Variation	[12]
Lung cancer	DISCM4YA	Strong	Biomarker	[6]
Lung carcinoma	DISTR26C	Strong	Biomarker	[6]
Neoplasm	DISZKGEW	Strong	Biomarker	[13]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[6]
Osteoarthritis	DIS05URM	Strong	Biomarker	[14]
Parkinson disease	DISQVHKL	Strong	Biomarker	[15]
Pituitary dwarfism	DISI019B	Strong	Genetic Variation	[16]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Genetic Variation	[17]
Split hand-foot malformation 3	DISIIYAQ	Strong	Biomarker	[18]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[8]
Breast carcinoma	DIS2UE88	moderate	Biomarker	[5]
Diabetic retinopathy	DISHGUJM	moderate	Biomarker	[19]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[20]
Asthma	DISW9QNS	Limited	Biomarker	[21]
Colorectal carcinoma	DIS5PYL0	Limited	Biomarker	[22]
Prostate cancer	DISF190Y	Limited	Biomarker	[23]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[23]
Type-1/2 diabetes	DISIUHAP	Limited	Genetic Variation	[24]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Chlorothiazide	DMLHESP	Approved	F-box only protein 8 (FBXO8) increases the Metabolic disorder ADR of Chlorothiazide.	[36]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of F-box only protein 8 (FBXO8).	[25]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of F-box only protein 8 (FBXO8).	[26]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of F-box only protein 8 (FBXO8).	[27]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of F-box only protein 8 (FBXO8).	[28]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of F-box only protein 8 (FBXO8).	[29]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of F-box only protein 8 (FBXO8).	[30]
Panobinostat	DM58WKG	Approved	Panobinostat affects the expression of F-box only protein 8 (FBXO8).	[31]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of F-box only protein 8 (FBXO8).	[32]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of F-box only protein 8 (FBXO8).	[33]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of F-box only protein 8 (FBXO8).	[34]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of F-box only protein 8 (FBXO8).	[35]

References

• [1] Extracellular vesicles derived from natural killer cells use multiple cytotoxic proteins and killing mechanisms to target cancer cells.J Extracell Vesicles. 2019 Mar 12;8(1):1588538. doi: 10.1080/20013078.2019.1588538. eCollection 2019.
• [2] HLA-G expression on blasts and tolerogenic cells in patients affected by acute myeloid leukemia.J Immunol Res. 2014;2014:636292. doi: 10.1155/2014/636292. Epub 2014 Mar 13.
• [3] Yeast-hybrid based high-throughput assay for identification of anthrax lethal factor inhibitors.Biochem Biophys Res Commun. 2011 Jan 7;404(1):517-22. doi: 10.1016/j.bbrc.2010.12.015. Epub 2010 Dec 6.
• [4] Different Lifestyle Interventions in AdultsFrom Underserved Communities: The FAMILIA Trial.J Am Coll Cardiol. 2020 Jan 7;75(1):42-56. doi: 10.1016/j.jacc.2019.10.021. Epub 2019 Nov 11.
• [5] A comparison of the inhibitory effect of nano-encapsulated helenalin and free helenalin on telomerase gene expression in the breast cancer cell line, by real-time PCR.Artif Cells Nanomed Biotechnol. 2016;44(2):695-703. doi: 10.3109/21691401.2014.981270. Epub 2014 Dec 1.
• [6] Establishment and characterization of primary lung cancer cell lines from Chinese population.Acta Pharmacol Sin. 2011 Mar;32(3):385-92. doi: 10.1038/aps.2010.214.
• [7] The benefits of angiotensin-converting enzyme inhibitors/angiotensin II receptor blockers combined with calcium channel blockers on metabolic, renal, and cardiovascular outcomes in hypertensive patients: a meta-analysis.Int Urol Nephrol. 2018 Dec;50(12):2261-2278. doi: 10.1007/s11255-018-1991-x. Epub 2018 Oct 15.
• [8] Significance of FBX8 in progression of gastric cancer.Exp Mol Pathol. 2015 Jun;98(3):360-6. doi: 10.1016/j.yexmp.2015.03.015. Epub 2015 Mar 20.
• [9] Inhibition of JMJD6 expression reduces the proliferation, migration and invasion of neuroglioma stem cells.Neoplasma. 2017;64(5):700-708. doi: 10.4149/neo_2017_507.
• [10] First bite syndrome - An 11-year experience.Auris Nasus Larynx. 2017 Jun;44(3):302-305. doi: 10.1016/j.anl.2016.07.012. Epub 2016 Aug 12.
• [11] miR-219 regulates liver cancer stem cell expansion via E-cadherin pathway.Cell Cycle. 2019 Dec;18(24):3550-3561. doi: 10.1080/15384101.2019.1691762. Epub 2019 Nov 14.
• [12] Dietary inflammatory index potentially increases blood pressure and markers of glucose homeostasis among adults: findings from an updated systematic review and meta-analysis.Public Health Nutr. 2020 Jun;23(8):1362-1380. doi: 10.1017/S1368980019003070. Epub 2019 Nov 11.
• [13] Tiny Rare-Earth Fluoride Nanoparticles Activate Tumour Cell Growth via Electrical Polar Interactions.Nanoscale Res Lett. 2018 Nov 21;13(1):370. doi: 10.1186/s11671-018-2775-z.
• [14] Autophagy promotes citrullination of VIM (vimentin) and its interaction with major histocompatibility complex class II in synovial fibroblasts.Autophagy. 2020 May;16(5):946-955. doi: 10.1080/15548627.2019.1664144. Epub 2019 Sep 8.
• [15] Bioassay-guided Isolation of Neuroprotective Fatty Acids from Nigella sativa against 1-methyl-4-phenylpyridinium-induced Neurotoxicity.Pharmacogn Mag. 2017 Oct-Dec;13(52):627-633. doi: 10.4103/pm.pm_470_16. Epub 2017 Nov 13.
• [16] Molecular genetic studies in isolated growth hormone deficiency (IGHD).Indian J Pediatr. 2013 Aug;80(8):623-30. doi: 10.1007/s12098-013-0982-2. Epub 2013 Feb 23.
• [17] Polymorphisms and haplotypes of insulin-like factor 3 gene are associated with risk of polycystic ovary syndrome in Indian women.Gene. 2016 Feb 15;577(2):180-6. doi: 10.1016/j.gene.2015.11.033. Epub 2015 Nov 25.
• [18] Bilaterally cleft lip and bilateral thumb polydactyly with triphalangeal component in a patient with two de novo deletions of HSA 4q32 and 4q34 involving PDGFC, GRIA2, and FBXO8 genes.Am J Med Genet A. 2013 Oct;161A(10):2656-62. doi: 10.1002/ajmg.a.36146. Epub 2013 Aug 16.
• [19] Differential expressions of SIRT1, SIRT3, and SIRT4 in peripheral blood mononuclear cells from patients with type 2 diabetic retinopathy.Arch Physiol Biochem. 2020 Oct;126(4):363-368. doi: 10.1080/13813455.2018.1543328. Epub 2018 Dec 20.
• [20] Aqueous stable Pd nanoparticles/covalent organic framework nanocomposite: an efficient nanoenzyme for colorimetric detection and multicolor imaging of cancer cells.Nanoscale. 2020 Jan 2;12(2):825-831. doi: 10.1039/c9nr08486j.
• [21] Contributions of direct versus indirect mechanisms for regulatory dendritic cell suppression of asthmatic allergen-specific IgG1 antibody responses.PLoS One. 2018 Jan 2;13(1):e0190414. doi: 10.1371/journal.pone.0190414. eCollection 2018.
• [22] FBX8 degrades GSTP1 through ubiquitination to suppress colorectal cancer progression.Cell Death Dis. 2019 Apr 25;10(5):351. doi: 10.1038/s41419-019-1588-z.
• [23] Finasteride upregulates expression of androgen receptor in hyperplastic prostate and LNCaP cells: implications for chemoprevention of prostate cancer.Prostate. 2011 Jul;71(10):1115-21. doi: 10.1002/pros.21325. Epub 2011 Jan 12.
• [24] Prevalence of high bloodpressure, hyperglycemia, dyslipidemia, metabolic syndrome and their determinants in Ethiopia: Evidences from the National NCDs STEPS Survey, 2015.PLoS One. 2018 May 9;13(5):e0194819. doi: 10.1371/journal.pone.0194819. eCollection 2018.
• [25] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [26] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [27] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [28] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [29] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [30] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [31] The Bromodomain Inhibitor JQ1 and the Histone Deacetylase Inhibitor Panobinostat Synergistically Reduce N-Myc Expression and Induce Anticancer Effects. Clin Cancer Res. 2016 May 15;22(10):2534-44. doi: 10.1158/1078-0432.CCR-15-1666. Epub 2016 Jan 5.
• [32] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [33] Loss of TRIM33 causes resistance to BET bromodomain inhibitors through MYC- and TGF-beta-dependent mechanisms. Proc Natl Acad Sci U S A. 2016 Aug 2;113(31):E4558-66.
• [34] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [35] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [36] Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans. Pharmacogenomics J. 2014 Feb;14(1):35-40. doi: 10.1038/tpj.2013.3. Epub 2013 Feb 12.