Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZQ2M6Y)

• DOT Name: Latexin (LXN)
• Synonyms: Endogenous carboxypeptidase inhibitor; ECI; Protein MUM; Tissue carboxypeptidase inhibitor; TCI
• Gene Name: LXN
• Related Disease:
  Peptic ulcer
  Adenocarcinoma
  Advanced cancer
  Atopic dermatitis
  Attention deficit hyperactivity disorder
  Carcinoma
  Chronic kidney disease
  Colorectal neoplasm
  Crohn disease
  Gastric cancer
  Haematological malignancy
  Hepatocellular carcinoma
  leukaemia
  Leukemia
  Listeriosis
  Lung adenocarcinoma
  Neoplasm
  Pancreatic cancer
  Prostate cancer
  Prostate carcinoma
  Ulcerative colitis
  Adult lymphoma
  Lymphoma
  Pediatric lymphoma
  Amyotrophic lateral sclerosis
  Anxiety disorder
  Breast cancer
  Breast carcinoma
  Depression
  Melanoma
• UniProt ID: LXN_HUMAN
• PDB ID: 2BO9
• Pfam ID: PF20630 ; PF06907
• Sequence:
  MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYHLKFAVEE
  IIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQ
  NIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDY
  TILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE
• Function: Hardly reversible, non-competitive, and potent inhibitor of CPA1, CPA2 and CPA4. May play a role in inflammation.
• Tissue Specificity: Highly expressed in heart, prostate, ovary, kidney, pancreas, and colon, moderate or low in other tissues including brain.

Molecular Interaction Atlas (MIA) of This DOT

30 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Peptic ulcer	DISL8XZI	Definitive	Genetic Variation	[1]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[2]
Atopic dermatitis	DISTCP41	Strong	Biomarker	[3]
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Biomarker	[4]
Carcinoma	DISH9F1N	Strong	Altered Expression	[5]
Chronic kidney disease	DISW82R7	Strong	Genetic Variation	[6]
Colorectal neoplasm	DISR1UCN	Strong	Biomarker	[7]
Crohn disease	DIS2C5Q8	Strong	Biomarker	[8]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[5]
Haematological malignancy	DISCDP7W	Strong	Altered Expression	[9]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[10]
leukaemia	DISS7D1V	Strong	Posttranslational Modification	[9]
Leukemia	DISNAKFL	Strong	Posttranslational Modification	[9]
Listeriosis	DISKMQBM	Strong	Biomarker	[11]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[12]
Neoplasm	DISZKGEW	Strong	Biomarker	[2]
Pancreatic cancer	DISJC981	Strong	Biomarker	[13]
Prostate cancer	DISF190Y	Strong	Biomarker	[14]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[14]
Ulcerative colitis	DIS8K27O	Strong	Altered Expression	[15]
Adult lymphoma	DISK8IZR	moderate	Biomarker	[9]
Lymphoma	DISN6V4S	moderate	Biomarker	[9]
Pediatric lymphoma	DIS51BK2	moderate	Biomarker	[9]
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Biomarker	[16]
Anxiety disorder	DISBI2BT	Limited	Biomarker	[17]
Breast cancer	DIS7DPX1	Limited	Altered Expression	[18]
Breast carcinoma	DIS2UE88	Limited	Altered Expression	[18]
Depression	DIS3XJ69	Limited	Genetic Variation	[19]
Melanoma	DIS1RRCY	Limited	Altered Expression	[20]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Latexin (LXN) affects the response to substance of Fluorouracil.	[40]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Latexin (LXN).	[21]

22 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Latexin (LXN).	[22]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Latexin (LXN).	[23]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Latexin (LXN).	[24]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Latexin (LXN).	[25]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Latexin (LXN).	[26]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Latexin (LXN).	[27]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Latexin (LXN).	[27]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Latexin (LXN).	[28]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Latexin (LXN).	[29]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Latexin (LXN).	[30]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Latexin (LXN).	[28]
Diclofenac	DMPIHLS	Approved	Diclofenac increases the expression of Latexin (LXN).	[28]
Piroxicam	DMTK234	Approved	Piroxicam increases the expression of Latexin (LXN).	[28]
Mifepristone	DMGZQEF	Approved	Mifepristone increases the expression of Latexin (LXN).	[31]
Lucanthone	DMZLBUO	Approved	Lucanthone increases the expression of Latexin (LXN).	[32]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Latexin (LXN).	[33]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the expression of Latexin (LXN).	[34]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Latexin (LXN).	[35]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Latexin (LXN).	[36]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Latexin (LXN).	[37]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Latexin (LXN).	[38]
biochanin A	DM0HPWY	Investigative	biochanin A increases the expression of Latexin (LXN).	[39]

References

• [1] Comorbidities and risk of mortality among hospitalized patients with idiopathic pulmonary fibrosis in Spain from 2002 to 2014.Respir Med. 2018 May;138:137-143. doi: 10.1016/j.rmed.2018.04.005. Epub 2018 Apr 11.
• [2] The putative tumour suppressor protein Latexin is secreted by prostate luminal cells and is downregulated in malignancy.Sci Rep. 2019 Mar 26;9(1):5120. doi: 10.1038/s41598-019-41379-8.
• [3] The effects of season and weather on healthcare utilization among patients with atopic dermatitis.J Eur Acad Dermatol Venereol. 2018 Oct;32(10):1745-1753. doi: 10.1111/jdv.15023. Epub 2018 May 31.
• [4] Screening with an ADHD-specific rating scale in preschoolers: A cross-cultural comparison of the Early Childhood Inventory-4.Psychol Assess. 2019 Aug;31(8):985-994. doi: 10.1037/pas0000722. Epub 2019 Apr 8.
• [5] Latexin expression is downregulated in human gastric carcinomas and exhibits tumor suppressor potential.BMC Cancer. 2011 Apr 6;11:121. doi: 10.1186/1471-2407-11-121.
• [6] Clinical Indices Can Standardize and Monitor Pediatric Care: A Novel Mechanism to Improve Quality and Safety.J Pediatr. 2018 Feb;193:190-195.e1. doi: 10.1016/j.jpeds.2017.09.073. Epub 2017 Dec 6.
• [7] Cell-free nucleic acids circulating in the plasma of colorectal cancer patients induce the oncogenic transformation of susceptible cultured cells.Cancer Res. 2010 Jan 15;70(2):560-7. doi: 10.1158/0008-5472.CAN-09-3513. Epub 2010 Jan 12.
• [8] Measurement of prostaglandin metabolites is useful in diagnosis of small bowel ulcerations.World J Gastroenterol. 2019 Apr 14;25(14):1753-1763. doi: 10.3748/wjg.v25.i14.1753.
• [9] Latexin is down-regulated in hematopoietic malignancies and restoration of expression inhibits lymphoma growth.PLoS One. 2012;7(9):e44979. doi: 10.1371/journal.pone.0044979. Epub 2012 Sep 27.
• [10] Latexin exhibits tumor suppressor potential in hepatocellular carcinoma.Oncol Rep. 2014 Mar;31(3):1364-72. doi: 10.3892/or.2014.2966. Epub 2014 Jan 8.
• [11] Multilocus sequence typing of outbreak-associated Listeria monocytogenes isolates to identify epidemic clones.Foodborne Pathog Dis. 2010 Mar;7(3):257-65. doi: 10.1089/fpd.2009.0342.
• [12] Prostaglandin E-Major Urinary Metabolite (PGE-MUM) as a Tumor Marker for Lung Adenocarcinoma.Cancers (Basel). 2019 Jun 3;11(6):768. doi: 10.3390/cancers11060768.
• [13] Latexin inhibits the proliferation of CD133+ miapaca-2 pancreatic cancer stem-like cells.World J Surg Oncol. 2014 Dec 30;12:404. doi: 10.1186/1477-7819-12-404.
• [14] Bone Microenvironment Changes in Latexin Expression Promote Chemoresistance.Mol Cancer Res. 2017 Apr;15(4):457-466. doi: 10.1158/1541-7786.MCR-16-0392. Epub 2017 Jan 13.
• [15] Prostaglandin E-major Urinary Metabolite as a Biomarker for Pediatric Ulcerative Colitis Activity.J Pediatr Gastroenterol Nutr. 2017 Jun;64(6):955-961. doi: 10.1097/MPG.0000000000001477.
• [16] Cognitive correlates in amyotrophic lateral sclerosis: a population-based study in Italy.J Neurol Neurosurg Psychiatry. 2015 Feb;86(2):168-73. doi: 10.1136/jnnp-2013-307223. Epub 2014 Apr 25.
• [17] Temperament clusters associate with anxiety disorder comorbidity in depression.J Affect Disord. 2018 Aug 15;236:252-258. doi: 10.1016/j.jad.2018.04.084. Epub 2018 Apr 23.
• [18] Clinical implications of AGBL2 expression and its inhibitor latexin in breast cancer.World J Surg Oncol. 2014 May 7;12:142. doi: 10.1186/1477-7819-12-142.
• [19] Psychopathological constellation in patients with PNES: A new hypothesis.Epilepsy Behav. 2018 Jan;78:297-301. doi: 10.1016/j.yebeh.2017.09.025. Epub 2017 Oct 29.
• [20] CEACAM1 promotes melanoma metastasis and is involved in the regulation of the EMT associated gene network in melanoma cells.Sci Rep. 2018 Aug 8;8(1):11893. doi: 10.1038/s41598-018-30338-4.
• [21] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [22] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [23] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [24] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [25] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [26] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [27] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [28] Antirheumatic drug response signatures in human chondrocytes: potential molecular targets to stimulate cartilage regeneration. Arthritis Res Ther. 2009;11(1):R15.
• [29] Epigenetic silencing of novel tumor suppressors in malignant melanoma. Cancer Res. 2006 Dec 1;66(23):11187-93. doi: 10.1158/0008-5472.CAN-06-1274.
• [30] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [31] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
• [32] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [33] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [34] Influence of cell cycle on responses of MCF-7 cells to benzo[a]pyrene. BMC Genomics. 2011 Jun 29;12:333.
• [35] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [36] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [37] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [38] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [39] Mechanisms of the growth inhibitory effects of the isoflavonoid biochanin A on LNCaP cells and xenografts. Prostate. 2002 Aug 1;52(3):201-12.
• [40] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.