Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0RFT8F)

DOT Name C-reactive protein (CRP)
Gene Name CRP
UniProt ID
CRP_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1B09; 1GNH; 1LJ7; 3L2Y; 3PVN; 3PVO; 7PK9; 7PKB; 7PKD; 7PKE; 7PKF; 7PKG; 7PKH; 7TBA
Pfam ID
PF00354
Sequence
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTE
LSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWES
ASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMW
DFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP
Function
Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells.
Tissue Specificity Found in plasma.
Reactome Pathway
Classical antibody-mediated complement activation (R-HSA-173623 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Lidocaine DML4ZOT Approved C-reactive protein (CRP) increases the Pyrexia ADR of Lidocaine. [53]
------------------------------------------------------------------------------------
53 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of C-reactive protein (CRP). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of C-reactive protein (CRP). [2]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of C-reactive protein (CRP). [3]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of C-reactive protein (CRP). [4]
Estradiol DMUNTE3 Approved Estradiol increases the expression of C-reactive protein (CRP). [5]
Ivermectin DMDBX5F Approved Ivermectin increases the expression of C-reactive protein (CRP). [6]
Arsenic DMTL2Y1 Approved Arsenic increases the expression of C-reactive protein (CRP). [7]
Quercetin DM3NC4M Approved Quercetin decreases the expression of C-reactive protein (CRP). [8]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of C-reactive protein (CRP). [9]
Testosterone DM7HUNW Approved Testosterone decreases the expression of C-reactive protein (CRP). [10]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of C-reactive protein (CRP). [11]
Folic acid DMEMBJC Approved Folic acid decreases the expression of C-reactive protein (CRP). [12]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the expression of C-reactive protein (CRP). [13]
Ethanol DMDRQZU Approved Ethanol increases the expression of C-reactive protein (CRP). [14]
Clozapine DMFC71L Approved Clozapine increases the expression of C-reactive protein (CRP). [15]
Ethinyl estradiol DMODJ40 Approved Ethinyl estradiol increases the expression of C-reactive protein (CRP). [16]
Cocaine DMSOX7I Approved Cocaine increases the expression of C-reactive protein (CRP). [17]
Simvastatin DM30SGU Approved Simvastatin decreases the expression of C-reactive protein (CRP). [18]
Obeticholic acid DM3Q1SM Approved Obeticholic acid decreases the expression of C-reactive protein (CRP). [19]
Fenofibrate DMFKXDY Approved Fenofibrate decreases the expression of C-reactive protein (CRP). [20]
Pioglitazone DMKJ485 Approved Pioglitazone decreases the expression of C-reactive protein (CRP). [21]
Thalidomide DM70BU5 Approved Thalidomide decreases the expression of C-reactive protein (CRP). [22]
Bezafibrate DMZDCS0 Approved Bezafibrate decreases the expression of C-reactive protein (CRP). [23]
Ardeparin DMYRX8B Approved Ardeparin decreases the expression of C-reactive protein (CRP). [24]
Morphine DMRMS0L Approved Morphine increases the expression of C-reactive protein (CRP). [25]
Eicosapentaenoic acid/docosa-hexaenoic acid DMMUCG4 Approved Eicosapentaenoic acid/docosa-hexaenoic acid affects the expression of C-reactive protein (CRP). [26]
Penicillamine DM40EF6 Approved Penicillamine decreases the expression of C-reactive protein (CRP). [27]
Vitamin B3 DMQVRZH Approved Vitamin B3 decreases the expression of C-reactive protein (CRP). [28]
Carvedilol DMHTEAO Approved Carvedilol decreases the expression of C-reactive protein (CRP). [29]
Abacavir DMMN36E Approved Abacavir increases the expression of C-reactive protein (CRP). [30]
Benzbromarone DMC3YUA Approved Benzbromarone decreases the expression of C-reactive protein (CRP). [31]
Tibolone DM78XFG Approved Tibolone increases the expression of C-reactive protein (CRP). [32]
Pamidronate DMB4AVP Approved Pamidronate decreases the expression of C-reactive protein (CRP). [33]
Indinavir DM0T3YH Approved Indinavir decreases the expression of C-reactive protein (CRP). [34]
Cenestin DMXQS7K Approved Cenestin increases the expression of C-reactive protein (CRP). [35]
Candesartan DMRK8OT Approved Candesartan decreases the expression of C-reactive protein (CRP). [36]
Eptifibatide DMQXTJS Approved Eptifibatide increases the expression of C-reactive protein (CRP). [37]
Rifamycin DMEH3O7 Approved Rifamycin affects the expression of C-reactive protein (CRP). [38]
Bivalirudin DMECRX1 Approved Bivalirudin decreases the expression of C-reactive protein (CRP). [39]
Vancomycin DM3JFIH Approved Vancomycin decreases the expression of C-reactive protein (CRP). [40]
Milrinone DM8TUPF Approved Milrinone decreases the expression of C-reactive protein (CRP). [41]
Fosfomycin DMVGPMX Approved Fosfomycin decreases the expression of C-reactive protein (CRP). [40]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of C-reactive protein (CRP). [42]
Atorvastatin DMF28YC Phase 3 Trial Atorvastatin decreases the expression of C-reactive protein (CRP). [43]
Telmisartan DMS3GX2 Phase 3 Trial Telmisartan decreases the expression of C-reactive protein (CRP). [44]
HE3286 DMB9U5E Phase 3 HE3286 decreases the expression of C-reactive protein (CRP). [45]
Tocopherol DMBIJZ6 Phase 2 Tocopherol decreases the expression of C-reactive protein (CRP). [46]
Acalabrutinib DM7GCVW Phase 2 Trial Acalabrutinib affects the expression of C-reactive protein (CRP). [47]
PMID26394986-Compound-22 DM43Z1G Patented PMID26394986-Compound-22 decreases the expression of C-reactive protein (CRP). [49]
PMID28870136-Compound-49 DMTUC9E Patented PMID28870136-Compound-49 decreases the expression of C-reactive protein (CRP). [50]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of C-reactive protein (CRP). [51]
Kaempferol DMHEMUB Investigative Kaempferol decreases the expression of C-reactive protein (CRP). [8]
PAF DMRZAQW Investigative PAF increases the expression of C-reactive protein (CRP). [52]
------------------------------------------------------------------------------------
⏷ Show the Full List of 53 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of C-reactive protein (CRP). [48]
------------------------------------------------------------------------------------

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
3 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
4 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5 Pro-inflammatory effects of oestrogens during use of oral contraceptives and hormone replacement treatment. Vascul Pharmacol. 2002 Aug;39(3):149-54. doi: 10.1016/s1537-1891(02)00304-x.
6 [Secondary effects of the treatment of hypermicrofilaremic loiasis using ivermectin]. Bull Soc Pathol Exot. 1995;88(3):105-12.
7 Increases in oxidized low-density lipoprotein and other inflammatory and adhesion molecules with a concomitant decrease in high-density lipoprotein in the individuals exposed to arsenic in Bangladesh. Toxicol Sci. 2013 Sep;135(1):17-25. doi: 10.1093/toxsci/kft130. Epub 2013 Jun 12.
8 The anti-inflammatory flavones quercetin and kaempferol cause inhibition of inducible nitric oxide synthase, cyclooxygenase-2 and reactive C-protein, and down-regulation of the nuclear factor kappaB pathway in Chang Liver cells. Eur J Pharmacol. 2007 Feb 28;557(2-3):221-9.
9 Calcitriol treatment attenuates inflammation and oxidative stress in hemodialysis patients with secondary hyperparathyroidism. Tohoku J Exp Med. 2011 Mar;223(3):153-9. doi: 10.1620/tjem.223.153.
10 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
11 Dose- and time-dependent effects of phenobarbital on gene expression profiling in human hepatoma HepaRG cells. Toxicol Appl Pharmacol. 2009 Feb 1;234(3):345-60.
12 Effect of short-term folic acid supplementation on insulin sensitivity and inflammatory markers in overweight subjects. Int J Obes (Lond). 2006 Aug;30(8):1197-202. doi: 10.1038/sj.ijo.0803265. Epub 2006 Feb 21.
13 Rapid effects of rosiglitazone treatment on endothelial function and inflammatory biomarkers. Arterioscler Thromb Vasc Biol. 2005 Sep;25(9):1804-9. doi: 10.1161/01.ATV.0000176192.16951.9a. Epub 2005 Jul 7.
14 Salvianolic acid B protects against chronic alcoholic liver injury via SIRT1-mediated inhibition of CRP and ChREBP in rats. Toxicol Lett. 2017 Feb 5;267:1-10. doi: 10.1016/j.toxlet.2016.12.010. Epub 2016 Dec 15.
15 Eosinophilia indicating subclinical clozapine-induced pericarditis. J Clin Psychiatry. 2007 Jul;68(7):1147-8. doi: 10.4088/jcp.v68n0726d.
16 Oral ethinyl estradiol, but not transdermal 17beta-estradiol, increases plasma C-reactive protein levels in men. Thromb Haemost. 2000 Aug;84(2):359-60.
17 Effect of cocaine usage on C-reactive protein, von Willebrand factor, and fibrinogen. Am J Cardiol. 2002 May 1;89(9):1133-5. doi: 10.1016/s0002-9149(02)02289-0.
18 Simvastatin combined with ramipril treatment in hypercholesterolemic patients. Hypertension. 2004 Aug;44(2):180-5. doi: 10.1161/01.HYP.0000133310.42762.25. Epub 2004 Jun 7.
19 Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
20 The effect of fenofibrate on serum paraoxonase activity and inflammatory markers in patients with combined hyperlipidemia. Kardiol Pol. 2005 Jun;62(6):526-30.
21 Endocannabinoid receptor blockade reduces alanine aminotransferase in polycystic ovary syndrome independent of weight loss. BMC Endocr Disord. 2017 Jul 14;17(1):41. doi: 10.1186/s12902-017-0194-2.
22 Intractable insomnia after cessation of treatment with thalidomide. Gastroenterology. 2001 May;120(6):1567-8. doi: 10.1053/gast.2001.24495.
23 Severe hypertriglyceridemia with insulin resistance is associated with systemic inflammation: reversal with bezafibrate therapy in a randomized controlled trial. Am J Med. 2002 Mar;112(4):275-80. doi: 10.1016/s0002-9343(01)01123-8.
24 Serum acute phase protein concentrations after hysterectomy with and without low-molecular-weight heparin thrombosis prophylaxis. Acta Obstet Gynecol Scand. 2005 Aug;84(8):752-5. doi: 10.1111/j.0001-6349.2005.00722.x.
25 Effect of opium addiction on new and traditional cardiovascular risk factors: do duration of addiction and route of administration matter?. Lipids Health Dis. 2008 Nov 3;7:42. doi: 10.1186/1476-511X-7-42.
26 Association of serum n-3 polyunsaturated fatty acids with C-reactive protein in men. Eur J Clin Nutr. 2012 Jun;66(6):736-41. doi: 10.1038/ejcn.2011.195. Epub 2011 Nov 23.
27 The influence of alclofenac treatment on acute-phase proteins, plasma tryptophan, and erythrocyte sedimentation rate in patients with rheumatoid arthritis. Curr Med Res Opin. 1975;3(5):286-97. doi: 10.1185/03007997509114779.
28 Effects of extended-release niacin on lipoprotein particle size, distribution, and inflammatory markers in patients with coronary artery disease. Am J Cardiol. 2006 Sep 15;98(6):743-5. doi: 10.1016/j.amjcard.2006.04.011. Epub 2006 Jul 26.
29 Effects of carvedilol on oxidative stress in polymorphonuclear and mononuclear cells in patients with essential hypertension. Am J Med. 2004 Apr 1;116(7):460-5. doi: 10.1016/j.amjmed.2003.10.029.
30 Changes in biomarkers of cardiovascular risk after a switch to abacavir in HIV-1-infected individuals receiving combination antiretroviral therapy. HIV Med. 2009 Nov;10(10):627-33.
31 Serum CRP in patients with gout and effects of benzbromarone. Int J Clin Pharmacol Ther. 2011 Mar;49(3):191-7. doi: 10.5414/cp201425.
32 Effects of hormone treatment on hemostasis variables. Climacteric. 2007 Oct;10 Suppl 2:32-7. doi: 10.1080/13697130701598548.
33 Pamidronate increases markers of bone formation in patients with multiple myeloma in plateau phase under interferon-alpha treatment. Calcif Tissue Int. 2001 May;68(5):285-90.
34 C-Reactive protein levels over time and cardiovascular risk in HIV-infected individuals suppressed on an indinavir-based regimen: AIDS Clinical Trials Group 5056s. AIDS. 2004 Dec 3;18(18):2434-7.
35 Effects of estrogen, raloxifene, and hormone replacement therapy on serum C-reactive protein and homocysteine levels. Maturitas. 2006 Feb 20;53(3):252-9. doi: 10.1016/j.maturitas.2005.05.006. Epub 2005 Jun 28.
36 Candesartan reduces oxidative stress and inflammation in patients with essential hypertension. Hypertens Res. 2003 Sep;26(9):691-7. doi: 10.1291/hypres.26.691.
37 Eptifibatide in peripheral vascular interventions: results of the Integrilin Reduces Inflammation in Peripheral Vascular Interventions (INFLAME) trial. J Invasive Cardiol. 2006 Jan;18(1):6-12.
38 Multiple intra-articular treatment of rheumatoid arthritis: a randomized prospective study comparing rifamycin SV with pefloxacin. J Int Med Res. 1992 Feb;20(1):27-39. doi: 10.1177/030006059202000104.
39 The effects of bivalirudin compared with those of unfractionated heparin plus eptifibatide on inflammation and thrombin generation and activity during coronary intervention. Coron Artery Dis. 2005 Sep;16(6):401-5. doi: 10.1097/00019501-200509000-00010.
40 [Successful treatment of MRSA-associated glomerulonephritis with antibiotic therapy]. Nihon Jinzo Gakkai Shi. 2003;45(1):37-41.
41 The efficacy of preemptive Milrinone or Amrinone therapy in patients undergoing coronary artery bypass grafting. Anesth Analg. 2002 Jan;94(1):22-30, table of contents. doi: 10.1097/00000539-200201000-00005.
42 Anti-inflammatory and antioxidant effects of resveratrol in healthy smokers a randomized, double-blind, placebo-controlled, cross-over trial. Curr Med Chem. 2013;20(10):1323-31. doi: 10.2174/0929867311320100009.
43 Effects of atorvastatin on inflammation and oxidative stress. Heart Vessels. 2005 Jul;20(4):133-6. doi: 10.1007/s00380-005-0833-9.
44 Improvement of endothelial function in patients with hypertension and type 2 diabetes after treatment with telmisartan. Hypertens Res. 2010 Aug;33(8):796-801. doi: 10.1038/hr.2010.107. Epub 2010 Jun 17.
45 Molecular targets for 17-ethynyl-5-androstene-3,7,17-triol, an anti-inflammatory agent derived from the human metabolome. PLoS One. 2012;7(2):e32147. doi: 10.1371/journal.pone.0032147. Epub 2012 Feb 24.
46 Vitamin E-coated cellulose acetate dialysis membrane: long-term effect on inflammation and oxidative stress. Ren Fail. 2010 Jan;32(3):287-93. doi: 10.3109/08860221003615795.
47 Inhibition of Bruton tyrosine kinase in patients with severe COVID-19. Sci Immunol. 2020 Jun 5;5(48):eabd0110. doi: 10.1126/sciimmunol.abd0110. Epub 2020 Jun 5.
48 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
49 Selective COX-2 inhibition improves endothelial function in coronary artery disease. Circulation. 2003 Jan 28;107(3):405-9. doi: 10.1161/01.cir.0000051361.69808.3a.
50 Therapy of ischemic cardiomyopathy with the immunomodulating agent pentoxifylline: results of a randomized study. Circulation. 2004 Feb 17;109(6):750-5. doi: 10.1161/01.CIR.0000112568.48837.60.
51 Induction of proinflammatory cytokines and C-reactive protein in human macrophage cell line U937 exposed to air pollution particulates. Environ Health Perspect. 2005 Nov;113(11):1536-41.
52 Oxidized phospholipid: POVPC binds to platelet-activating-factor receptor on human macrophagesImplications in atherosclerosis. Atherosclerosis. 2006 Oct;188(2):433-43.
53 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.