Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0XT3JU)

DOT Name	Ribulose-phosphate 3-epimerase (RPE)
Synonyms	EC 5.1.3.1; Ribulose-5-phosphate-3-epimerase
Gene Name	RPE
Related Disease	Neoplasm ( ) Paralysis ( ) Advanced cancer ( ) Atrial fibrillation ( ) Carcinoma of liver and intrahepatic biliary tract ( ) Chronic recurrent multifocal osteomyelitis ( ) CINCA syndrome ( ) Colon cancer ( ) Cytomegalovirus infection ( ) Diabetic macular edema ( ) Diabetic retinopathy ( ) Disorder of orbital region ( ) Doyne honeycomb retinal dystrophy ( ) Familial adenomatous polyposis ( ) Hamartoma ( ) Hepatocellular carcinoma ( ) Hereditary macular dystrophy ( ) Hypopigmentation of the skin ( ) Inherited retinal dystrophy ( ) Leber congenital amaurosis 1 ( ) Leber congenital amaurosis 2 ( ) Liver cancer ( ) Macular degeneration ( ) Myopia ( ) Proliferative diabetic retinopathy ( ) Proliferative vitreoretinopathy ( ) Retinitis pigmentosa ( ) Retinoblastoma ( ) Retinoschisis ( ) Rhegmatogenous retinal detachment ( ) Severe early-childhood-onset retinal dystrophy ( ) Sorsby fundus dystrophy ( ) Uveitis ( ) Vitelliform macular dystrophy ( ) Zika virus infection ( ) Cardiovascular disease ( ) Retinopathy ( ) Stargardt disease ( ) Melanoma ( ) Blindness ( ) Choroideremia ( ) Glycogen storage disease type II ( ) Helicoid peripapillary chorioretinal degeneration ( ) Non-insulin dependent diabetes ( )
UniProt ID	RPE_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	3OVP; 3OVQ; 3OVR; 3QC3
EC Number	5.1.3.1
Pfam ID	PF00834
Sequence	MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ LGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK PGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGP DTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR
Function	Catalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate.
KEGG Pathway	Pentose phosphate pathway (hsa00030 ) Pentose and glucuro.te interconversions (hsa00040 ) Metabolic pathways (hsa01100 ) Carbon metabolism (hsa01200 ) Biosynthesis of amino acids (hsa01230 )
Reactome Pathway	Pentose phosphate pathway (R-HSA-71336 )

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Neoplasm	DISZKGEW	Definitive	Biomarker	[1]
Paralysis	DISF9I3O	Definitive	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Atrial fibrillation	DIS15W6U	Strong	Biomarker	[4]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Biomarker	[5]
Chronic recurrent multifocal osteomyelitis	DIST1OU2	Strong	Altered Expression	[6]
CINCA syndrome	DISU6RZC	Strong	Genetic Variation	[7]
Colon cancer	DISVC52G	Strong	Biomarker	[8]
Cytomegalovirus infection	DISCEMGC	Strong	Altered Expression	[9]
Diabetic macular edema	DIS162FN	Strong	Biomarker	[10]
Diabetic retinopathy	DISHGUJM	Strong	Biomarker	[11]
Disorder of orbital region	DISH0ECJ	Strong	Biomarker	[12]
Doyne honeycomb retinal dystrophy	DISKFNCT	Strong	Genetic Variation	[13]
Familial adenomatous polyposis	DISW53RE	Strong	Biomarker	[14]
Hamartoma	DIS0I87H	Strong	Genetic Variation	[15]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[16]
Hereditary macular dystrophy	DISEYSYY	Strong	Biomarker	[17]
Hypopigmentation of the skin	DIS39YKC	Strong	Biomarker	[18]
Inherited retinal dystrophy	DISGGL77	Strong	Genetic Variation	[19]
Leber congenital amaurosis 1	DISY2B33	Strong	Genetic Variation	[20]
Leber congenital amaurosis 2	DISF39MM	Strong	Biomarker	[12]
Liver cancer	DISDE4BI	Strong	Biomarker	[5]
Macular degeneration	DISLKKHD	Strong	Biomarker	[21]
Myopia	DISK5S60	Strong	Biomarker	[22]
Proliferative diabetic retinopathy	DISQZ13G	Strong	Biomarker	[23]
Proliferative vitreoretinopathy	DISZTEK1	Strong	Biomarker	[24]
Retinitis pigmentosa	DISCGPY8	Strong	Biomarker	[25]
Retinoblastoma	DISVPNPB	Strong	Biomarker	[26]
Retinoschisis	DISTTWND	Strong	Biomarker	[27]
Rhegmatogenous retinal detachment	DISLE27J	Strong	Biomarker	[28]
Severe early-childhood-onset retinal dystrophy	DISFDRFO	Strong	Biomarker	[29]
Sorsby fundus dystrophy	DISFVBJE	Strong	Biomarker	[13]
Uveitis	DISV0RYS	Strong	Biomarker	[30]
Vitelliform macular dystrophy	DISEFYYN	Strong	Genetic Variation	[31]
Zika virus infection	DISQUCTY	Strong	Biomarker	[32]
Cardiovascular disease	DIS2IQDX	moderate	Biomarker	[33]
Retinopathy	DISB4B0F	moderate	Biomarker	[34]
Stargardt disease	DISPXOTO	moderate	Biomarker	[35]
Melanoma	DIS1RRCY	Disputed	Genetic Variation	[36]
Blindness	DISTIM10	Limited	Genetic Variation	[19]
Choroideremia	DISH4N9B	Limited	Biomarker	[37]
Glycogen storage disease type II	DISXZPBC	Limited	Biomarker	[36]
Helicoid peripapillary chorioretinal degeneration	DISFSS5N	Limited	Biomarker	[38]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Biomarker	[33]
------------------------------------------------------------------------------------


⏷ Show the Full List of 44 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Ribulose-phosphate 3-epimerase (RPE).	[39]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Ribulose-phosphate 3-epimerase (RPE).	[40]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Ribulose-phosphate 3-epimerase (RPE).	[41]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Ribulose-phosphate 3-epimerase (RPE).	[42]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Ribulose-phosphate 3-epimerase (RPE).	[43]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Ribulose-phosphate 3-epimerase (RPE).	[44]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Ribulose-phosphate 3-epimerase (RPE).	[45]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Ribulose-phosphate 3-epimerase (RPE).	[46]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Ribulose-phosphate 3-epimerase (RPE).	[47]
------------------------------------------------------------------------------------


⏷ Show the Full List of 9 Drug(s)

References

1	A role for metaphase spindle elongation forces in correction of merotelic kinetochore attachments.Curr Biol. 2012 Feb 7;22(3):225-30. doi: 10.1016/j.cub.2011.12.022. Epub 2012 Jan 19.
2	Modeling Perceived Exertion during Graded Arm Cycling Exercise in Spinal Cord Injury.Med Sci Sports Exerc. 2017 Jun;49(6):1190-1196. doi: 10.1249/MSS.0000000000001203.
3	Centrosome amplification induces high grade features and is prognostic of worse outcomes in breast cancer.BMC Cancer. 2016 Jan 29;16:47. doi: 10.1186/s12885-016-2083-x.
4	Mutations in GPR143/OA1 and ABCA4 Inform Interpretations of Short-Wavelength and Near-Infrared Fundus Autofluorescence.Invest Ophthalmol Vis Sci. 2018 May 1;59(6):2459-2469. doi: 10.1167/iovs.18-24213.
5	Synthesis, Docking Studies into CDK-2 and Anticancer Activity of New Derivatives Based Pyrimidine Scaffold and Their Derived Glycosides.Mini Rev Med Chem. 2019;19(13):1093-1110. doi: 10.2174/1389557519666190312165717.
6	Quantitative analysis of vitreous inflammation using optical coherence tomography in patients receiving sub-Tenon's triamcinolone acetonide for uveitic cystoid macular oedema.Br J Ophthalmol. 2017 Feb;101(2):175-179. doi: 10.1136/bjophthalmol-2015-308008. Epub 2016 May 5.
7	Issues with the Specificity of Immunological Reagents for NLRP3: Implications for Age-related Macular Degeneration.Sci Rep. 2018 Jan 11;8(1):461. doi: 10.1038/s41598-017-17634-1.
8	Antiproliferative Effects of the Natural Oxadiazine Nocuolin A Are Associated With Impairment of Mitochondrial Oxidative Phosphorylation.Front Oncol. 2019 Apr 3;9:224. doi: 10.3389/fonc.2019.00224. eCollection 2019.
9	Stepwise adaptation of murine cytomegalovirus to cells of a foreign host for identification of host range determinants.Med Microbiol Immunol. 2015 Jun;204(3):461-9. doi: 10.1007/s00430-015-0400-7. Epub 2015 Mar 19.
10	Aqueous humour concentrations of PEDF and Erythropoietin are not influenced by subthreshold micropulse laser treatment of diabetic macular edema.Biosci Rep. 2019 Jun 18;39(6):BSR20190328. doi: 10.1042/BSR20190328. Print 2019 Jun 28.
11	Opioid Receptor Agonism Preserves the Retinal Pigmented Epithelial Cell Tight Junctions and Ameliorates the Retinopathy in Experimental Diabetes.Invest Ophthalmol Vis Sci. 2019 Sep 3;60(12):3842-3853. doi: 10.1167/iovs.19-26761.
12	Targeted Multifunctional Lipid ECO Plasmid DNA Nanoparticles as Efficient Non-viral Gene Therapy for Leber's Congenital Amaurosis.Mol Ther Nucleic Acids. 2017 Jun 16;7:42-52. doi: 10.1016/j.omtn.2017.02.005. Epub 2017 Feb 28.
13	Drusen in patient-derived hiPSC-RPE models of macular dystrophies.Proc Natl Acad Sci U S A. 2017 Sep 26;114(39):E8214-E8223. doi: 10.1073/pnas.1710430114. Epub 2017 Sep 6.
14	Congenital hypertrophy of the retinal pigment epithelium associated with familial adenomatous polyposis.Retina. 1994;14(1):6-9. doi: 10.1097/00006982-199401000-00002.
15	Peripapillary Versus Macular Combined Hamartoma of the Retina and Retinal Pigment Epithelium: Imaging Characteristics.Am J Ophthalmol. 2019 Apr;200:263-269. doi: 10.1016/j.ajo.2019.01.016. Epub 2019 Jan 26.
16	First Synthesis for Bis-Spirothiazolidine Derivatives as a Novel Heterocyclic Framework and Their Biological Activity.Mini Rev Med Chem. 2020;20(2):152-160. doi: 10.2174/1389557519666190920114852.
17	Early Onset Ultrastructural and Functional Defects in RPE and Photoreceptors of a Stargardt-Like Macular Dystrophy (STGD3) Transgenic Mouse Model.Invest Ophthalmol Vis Sci. 2015 Nov;56(12):7109-21. doi: 10.1167/iovs.15-17567.
18	Choroideremia: analysis of the retina from a female symptomatic carrier.Ophthalmic Genet. 2008 Sep;29(3):99-110. doi: 10.1080/13816810802206499.
19	Developing Cell-Based Therapies for RPE-Associated Degenerative Eye Diseases.Adv Exp Med Biol. 2019;1186:55-97. doi: 10.1007/978-3-030-28471-8_3.
20	Leber's congenital amaurosis and the role of gene therapy in congenital retinal disorders.Int J Ophthalmol. 2017 Mar 18;10(3):480-484. doi: 10.18240/ijo.2017.03.24. eCollection 2017.
21	Protective Effect of Met12, a Small Peptide Inhibitor of Fas, on the Retinal Pigment Epithelium and Photoreceptor After Sodium Iodate Injury.Invest Ophthalmol Vis Sci. 2017 Mar 1;58(3):1801-1810. doi: 10.1167/iovs.16-21392.
22	Improving the structure-function relationship in glaucomatous and normative eyes by incorporating photoreceptor layer thickness.Sci Rep. 2018 Jul 11;8(1):10450. doi: 10.1038/s41598-018-28821-z.
23	miRNA-451a regulates RPE function through promoting mitochondrial function in proliferative diabetic retinopathy.Am J Physiol Endocrinol Metab. 2019 Mar 1;316(3):E443-E452. doi: 10.1152/ajpendo.00360.2018. Epub 2018 Dec 21.
24	Substance P prevents development of proliferative vitreoretinopathy in mice by modulating TNF-.Mol Vis. 2017 Dec 13;23:933-943. eCollection 2017.
25	A novel start codon mutation of the MERTK gene in a patient with retinitis pigmentosa.Mol Vis. 2016 Apr 21;22:342-51. eCollection 2016.
26	Retinoic acid and dexamethasone regulate the expression of PEDF in retinal and endothelial cells.Exp Eye Res. 2004 May;78(5):945-55. doi: 10.1016/j.exer.2003.12.013.
27	Retinoschisis in eyes with pachychoroid and retinal pigment epithelial atrophy.Graefes Arch Clin Exp Ophthalmol. 2019 Sep;257(9):1863-1871. doi: 10.1007/s00417-019-04388-x. Epub 2019 Jun 20.
28	Comparison between refractive outcomes between macula-on and macula-off retinal detachments after phaco-vitrectomy.Jpn J Ophthalmol. 2019 Jul;63(4):310-316. doi: 10.1007/s10384-019-00667-6. Epub 2019 Apr 20.
29	Quantitative fundus autofluorescence in recessive Stargardt disease.Invest Ophthalmol Vis Sci. 2014 May 1;55(5):2841-52. doi: 10.1167/iovs.13-13624.
30	Targeting the Nrf2 Signaling Pathway in the Retina With a Gene-Delivered Secretable and Cell-Penetrating Peptide.Invest Ophthalmol Vis Sci. 2016 Feb;57(2):372-86. doi: 10.1167/iovs.15-17703.
31	Mutations of VMD2 splicing regulators cause nanophthalmos and autosomal dominant vitreoretinochoroidopathy (ADVIRC). Invest Ophthalmol Vis Sci. 2004 Oct;45(10):3683-9. doi: 10.1167/iovs.04-0550.
32	Zika virus causes supernumerary foci with centriolar proteins and impaired spindle positioning.Open Biol. 2017 Jan;7(1):160231. doi: 10.1098/rsob.160231.
33	Twelve weeks of low volume sprint interval training improves cardio-metabolic health outcomes in overweight females.J Sports Sci. 2019 Jun;37(11):1257-1264. doi: 10.1080/02640414.2018.1554615. Epub 2018 Dec 18.
34	SEQUENTIAL CHANGES IN HYDROXYCHLOROQUINE RETINOPATHY UP TO 20 YEARS AFTER STOPPING THE DRUG: Implications for Mild Versus Severe Toxicity.Retina. 2019 Mar;39(3):492-501. doi: 10.1097/IAE.0000000000002408.
35	Di-retinoid-pyridinium-ethanolamine (A2E) Accumulation and the Maintenance of the Visual Cycle Are Independent of Atg7-mediated Autophagy in the Retinal Pigmented Epithelium.J Biol Chem. 2015 Nov 27;290(48):29035-44. doi: 10.1074/jbc.M115.682310. Epub 2015 Oct 14.
36	A Role for A3/A1-Crystallin in Type 2 EMT of RPE Cells Occurring in Dry Age-Related Macular Degeneration.Invest Ophthalmol Vis Sci. 2018 Mar 20;59(4):AMD104-AMD113. doi: 10.1167/iovs.18-24132.
37	Near-infrared autofluorescence in young choroideremia patients.Ophthalmic Genet. 2019 Oct;40(5):421-427. doi: 10.1080/13816810.2019.1666881. Epub 2019 Sep 21.
38	Yap and Taz regulate retinal pigment epithelial cell fate.Development. 2015 Sep 1;142(17):3021-32. doi: 10.1242/dev.119008. Epub 2015 Jul 24.
39	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
40	Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
41	Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
42	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
43	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
44	Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
45	Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
46	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
47	Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.