Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT37I8JL)

DOT Name Inactive C-alpha-formylglycine-generating enzyme 2 (SUMF2)
Synonyms Paralog of formylglycine-generating enzyme; pFGE; Sulfatase-modifying factor 2
Gene Name SUMF2
Related Disease
Arthritis ( )
Ataxia-telangiectasia ( )
Bacillary dysentery ( )
Bacteremia ( )
Bacterial meningitis ( )
Campylobacteriosis ( )
Candidemia ( )
Central diabetes insipidus ( )
Colorectal carcinoma ( )
Immunodeficiency 67 ( )
Impetigo ( )
Inflammatory bowel disease ( )
Irritable bowel syndrome ( )
Keratitis ( )
Legionellosis ( )
Listeriosis ( )
Meningitis ( )
Methicillin-resistant staphylococci infection ( )
Salmonella infection ( )
Vibrio cholerae infection ( )
Pharyngitis ( )
Toxic shock syndrome ( )
Bacterial arthritis ( )
Cystic fibrosis ( )
Cystitis ( )
facioscapulohumeral muscular dystrophy ( )
Hemolytic-uremic syndrome ( )
Infective arthritis ( )
Marfan syndrome ( )
Osteomyelitis ( )
UniProt ID
SUMF2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1Y4J
Pfam ID
PF03781
Sequence
MARHGLPLLPLLSLLVGAWLKLGNGQATSMVQLQGGRFLMGTNSPDSRDGDGPVREATVK
PFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLP
VEKAFWRQPAGPGSGIRERLEHPVLHVSWNDARAYCAWRGKRLPTEEEWEFAARGGLKGQ
VYPWGNWFQPNRTNLWQGKFPKGDKAEDGFHGVSPVNAFPAQNNYGLYDLLGNVWEWTAS
PYQAAEQDMRVLRGASWIDTADGSANHRARVTTRMGNTPDSASDNLGFRCAADAGRPPGE
L
Function Lacks formylglycine generating activity and is unable to convert newly synthesized inactive sulfatases to their active form. Inhibits the activation of sulfatases by SUMF1.
Tissue Specificity Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highest levels in kidney, liver and placenta.
Reactome Pathway
Glycosphingolipid catabolism (R-HSA-9840310 )
The activation of arylsulfatases (R-HSA-1663150 )

Molecular Interaction Atlas (MIA) of This DOT

30 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Arthritis DIST1YEL Strong Genetic Variation [1]
Ataxia-telangiectasia DISP3EVR Strong Genetic Variation [2]
Bacillary dysentery DISFZHKN Strong Biomarker [3]
Bacteremia DIS6N9RZ Strong Biomarker [4]
Bacterial meningitis DISRP9SL Strong Biomarker [5]
Campylobacteriosis DISF18CN Strong Biomarker [6]
Candidemia DISVKFN7 Strong Biomarker [7]
Central diabetes insipidus DISJ4P9O Strong Genetic Variation [8]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [9]
Immunodeficiency 67 DISPZ7R1 Strong Genetic Variation [1]
Impetigo DISOF023 Strong Biomarker [10]
Inflammatory bowel disease DISGN23E Strong Biomarker [11]
Irritable bowel syndrome DIS27206 Strong Genetic Variation [12]
Keratitis DISMFOEI Strong Biomarker [13]
Legionellosis DISHA0ML Strong Biomarker [14]
Listeriosis DISKMQBM Strong Biomarker [15]
Meningitis DISQABAA Strong Genetic Variation [1]
Methicillin-resistant staphylococci infection DIS6DRDZ Strong Genetic Variation [16]
Salmonella infection DISTJ434 Strong Biomarker [17]
Vibrio cholerae infection DISW7E3U Strong Genetic Variation [18]
Pharyngitis DISSN548 moderate Genetic Variation [19]
Toxic shock syndrome DISX5S53 Disputed Biomarker [20]
Bacterial arthritis DIS8R241 Limited Biomarker [21]
Cystic fibrosis DIS2OK1Q Limited Biomarker [13]
Cystitis DIS2D4B9 Limited Biomarker [22]
facioscapulohumeral muscular dystrophy DISSE0H0 Limited Biomarker [23]
Hemolytic-uremic syndrome DISSCBGW Limited Biomarker [24]
Infective arthritis DIS8YJPR Limited Biomarker [21]
Marfan syndrome DISVEUWZ Limited Biomarker [25]
Osteomyelitis DIS0VUZL Limited Biomarker [21]
------------------------------------------------------------------------------------
⏷ Show the Full List of 30 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Inactive C-alpha-formylglycine-generating enzyme 2 (SUMF2). [26]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Inactive C-alpha-formylglycine-generating enzyme 2 (SUMF2). [27]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of Inactive C-alpha-formylglycine-generating enzyme 2 (SUMF2). [28]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Inactive C-alpha-formylglycine-generating enzyme 2 (SUMF2). [29]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Inactive C-alpha-formylglycine-generating enzyme 2 (SUMF2). [28]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Inactive C-alpha-formylglycine-generating enzyme 2 (SUMF2). [31]
GALLICACID DM6Y3A0 Investigative GALLICACID decreases the expression of Inactive C-alpha-formylglycine-generating enzyme 2 (SUMF2). [32]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Inactive C-alpha-formylglycine-generating enzyme 2 (SUMF2). [30]
------------------------------------------------------------------------------------

References

1 Recurrent infection with genetically identical pneumococcal isolates in a patient with interleukin-1 receptor-associated kinase-4 deficiency.J Med Microbiol. 2007 Jun;56(Pt 6):863-865. doi: 10.1099/jmm.0.47046-0.
2 Fine mapping of the chromosome 11q22-23 region using PFGE, linkage and haplotype analysis; localization of the gene for ataxia telangiectasia to a 5cM region flanked by NCAM/DRD2 and STMY/CJ52.75, phi 2.22.Nucleic Acids Res. 1990 Aug 11;18(15):4335-43. doi: 10.1093/nar/18.15.4335.
3 Clonal dissemination of a single Shigella sonnei strain among Iranian children during Fall 2012 in Tehran, I.R. Iran.Infect Genet Evol. 2015 Aug;34:260-6. doi: 10.1016/j.meegid.2015.06.024. Epub 2015 Jun 24.
4 Molecular epidemiology of Pseudomonas aeruginosa isolated from infected ICU patients: a French multicenter 2012-2013 study.Eur J Clin Microbiol Infect Dis. 2019 May;38(5):921-926. doi: 10.1007/s10096-019-03519-w. Epub 2019 Mar 2.
5 Phenotypic and molecular characterization of serogroup C Neisseria meningitidis associated with an outbreak in Bahia, Brazil.Enferm Infecc Microbiol Clin. 2012 Feb;30(2):56-9. doi: 10.1016/j.eimc.2011.07.022. Epub 2011 Nov 9.
6 Confirmation of a Campylobacteriosis Outbreak Associated with Chicken Liver Pt Using PFGE and WGS.Zoonoses Public Health. 2017 Feb;64(1):14-20. doi: 10.1111/zph.12272. Epub 2016 Jun 23.
7 Breakthrough Lactobacillus rhamnosus GG bacteremia associated with probiotic use in an adult patient with severe active ulcerative colitis: case report and review of the literature.Infection. 2015 Dec;43(6):777-81. doi: 10.1007/s15010-015-0798-2. Epub 2015 May 30.
8 Typing and susceptibility of bacterial isolates from the fidaxomicin (OPT-80) phase II study for C. difficile infection.Anaerobe. 2009 Dec;15(6):234-6. doi: 10.1016/j.anaerobe.2009.09.005. Epub 2009 Sep 12.
9 Discovery of Aberrant Alteration of Genome in Colorectal Cancer by Exome Sequencing.Am J Med Sci. 2019 Nov;358(5):340-349. doi: 10.1016/j.amjms.2019.07.012. Epub 2019 Aug 1.
10 S. aureus PFGE patterns of lesional or non lesional strains from patients with impetigo: association of individual bands with lesional or non lesional areas.New Microbiol. 2000 Jan;23(1):29-36.
11 Analysis of Escherichia coli isolated from patients affected by Crohn's disease.Curr Microbiol. 2011 Aug;63(2):131-7. doi: 10.1007/s00284-011-9947-8. Epub 2011 May 28.
12 Carriage of Clostridium difficile in outpatients with irritable bowel syndrome.J Med Microbiol. 2012 Sep;61(Pt 9):1290-1294. doi: 10.1099/jmm.0.040568-0. Epub 2012 May 11.
13 Intraclonal genetic diversity amongst cystic fibrosis and keratitis isolates of Pseudomonas aeruginosa.J Med Microbiol. 2013 Feb;62(Pt 2):208-216. doi: 10.1099/jmm.0.048272-0. Epub 2012 Oct 25.
14 A legionellosis case due to contaminated spa water and confirmed by genomic identification in Taiwan.Microbiol Immunol. 2006;50(5):371-7. doi: 10.1111/j.1348-0421.2006.tb03803.x.
15 Genomic characterization of Listeria monocytogenes strains involved in a multistate listeriosis outbreak associated with cantaloupe in US.PLoS One. 2012;7(7):e42448. doi: 10.1371/journal.pone.0042448. Epub 2012 Jul 31.
16 Staphylococcus aureus Infecting and Colonizing Experimental Animals, Macaques, in a Research Animal Facility.Microb Drug Resist. 2019 Jan/Feb;25(1):54-62. doi: 10.1089/mdr.2018.0232. Epub 2018 Nov 27.
17 Molecular characterization and resistance profile of Salmonella Enteritidis PT4 and PT9 strains isolated in Brazil.J Med Microbiol. 2011 Jul;60(Pt 7):1026-1031. doi: 10.1099/jmm.0.028597-0. Epub 2011 Apr 1.
18 Drug response and genetic properties of Vibrio cholerae associated with endemic cholera in north-eastern Thailand, 2003-2011.J Med Microbiol. 2013 Apr;62(Pt 4):599-609. doi: 10.1099/jmm.0.053801-0. Epub 2013 Jan 14.
19 Emergence of high-level fluoroquinolone resistance in emm6 Streptococcus pyogenes and in vitro resistance selection with ciprofloxacin, levofloxacin and moxifloxacin.J Antimicrob Chemother. 2009 May;63(5):886-94. doi: 10.1093/jac/dkp057. Epub 2009 Mar 11.
20 Antimicrobial resistance profiling and molecular typing of methicillin-resistant Staphylococcus aureus isolated from a Malaysian teaching hospital.J Med Microbiol. 2016 Dec;65(12):1476-1481. doi: 10.1099/jmm.0.000387. Epub 2016 Nov 7.
21 Staphylococcus aureus osteoarticular infections in children: an 8-year review of molecular microbiology, antibiotic resistance and clinical characteristics.J Med Microbiol. 2018 Dec;67(12):1753-1760. doi: 10.1099/jmm.0.000859. Epub 2018 Oct 23.
22 UPEC strain characterization isolated from Mexican patients with recurrent urinary infections.J Infect Dev Ctries. 2016 Apr 28;10(4):317-28. doi: 10.3855/jidc.6652.
23 A new dosage test for subtelomeric 4;10 translocations improves conventional diagnosis of facioscapulohumeral muscular dystrophy (FSHD).J Med Genet. 1999 Nov;36(11):823-8.
24 Genomic comparisons and Shiga toxin production among Escherichia coli O157:H7 isolates from a day care center outbreak and sporadic cases in southeastern Wisconsin.J Clin Microbiol. 1998 Mar;36(3):727-33. doi: 10.1128/JCM.36.3.727-733.1998.
25 Co-infection with two different Campylobacter jejuni strains in a patient with the Guillain-Barr syndrome.Microbes Infect. 2006 Jan;8(1):248-53. doi: 10.1016/j.micinf.2005.06.022. Epub 2005 Sep 13.
26 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
27 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
28 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
29 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
30 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
31 Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
32 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.