Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT45AJT3)

• DOT Name: G-protein coupled receptor family C group 5 member C (GPRC5C)
• Synonyms: Retinoic acid-induced gene 3 protein; RAIG-3
• Gene Name: GPRC5C
• Related Disease:
  Acromegaly
  Acute myelogenous leukaemia
  Advanced cancer
  Autoimmune disease
  Bilateral frontoparietal polymicrogyria
  Cardiovascular disease
  Colorectal carcinoma
  Esophageal squamous cell carcinoma
  Hepatocellular carcinoma
  Huntington disease
  Hypotrichosis
  Immunodeficiency
  Lung cancer
  Lung carcinoma
  Mood disorder
  Neoplasm
  Pituitary gigantism
  Plasma cell myeloma
  Schizophrenia
  Small-cell lung cancer
  Bipolar disorder
  Glaucoma/ocular hypertension
  Parkinson disease
  Type-1/2 diabetes
• UniProt ID: GPC5C_HUMAN
• Pfam ID: PF00003
• Sequence:
  MAIHKALVMCLGLPLFLFPGAWAQGHVPPGCSQGLNPLYYNLCDRSGAWGIVLEAVAGAG
  IVTTFVLTIILVASLPFVQDTKKRSLLGTQVFFLLGTLGLFCLVFACVVKPDFSTCASRR
  FLFGVLFAICFSCLAAHVFALNFLARKNHGPRGWVIFTVALLLTLVEVIINTEWLIITLV
  RGSGEGGPQGNSSAGWAVASPCAIANMDFVMALIYVMLLLLGAFLGAWPALCGRYKRWRK
  HGVFVLLTTATSVAIWVVWIVMYTYGNKQHNSPTWDDPTLAIALAANAWAFVLFYVIPEV
  SQVTKSSPEQSYQGDMYPTRGVGYETILKEQKGQSMFVENKAFSMDEPVAAKRPVSPYSG
  YNGQLLTSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQ
  AATPPKDGKNSQVFRNPYVWD
• Function: This retinoic acid-inducible G-protein coupled receptor provide evidence for a possible interaction between retinoid and G-protein signaling pathways.
• Tissue Specificity: Expression is highest in the periphery, particularly in the stomach, but also in the kidney, liver, pancreas, and prostate. In brain, levels of expression are generally lower than in the periphery, with the exception of cerebellum, spinal cord, and dorsal root ganglia (DRG).

Molecular Interaction Atlas (MIA) of This DOT

24 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acromegaly	DISCC73U	Strong	Biomarker	[1]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Autoimmune disease	DISORMTM	Strong	Biomarker	[4]
Bilateral frontoparietal polymicrogyria	DIS9DK0G	Strong	Genetic Variation	[5]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[6]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[7]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[8]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[9]
Huntington disease	DISQPLA4	Strong	Biomarker	[10]
Hypotrichosis	DISSW933	Strong	Genetic Variation	[11]
Immunodeficiency	DIS093I0	Strong	Biomarker	[12]
Lung cancer	DISCM4YA	Strong	Altered Expression	[13]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[13]
Mood disorder	DISLVMWO	Strong	Genetic Variation	[14]
Neoplasm	DISZKGEW	Strong	Biomarker	[15]
Pituitary gigantism	DISIUHNT	Strong	Biomarker	[1]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[16]
Schizophrenia	DISSRV2N	Strong	Altered Expression	[17]
Small-cell lung cancer	DISK3LZD	Strong	Altered Expression	[13]
Bipolar disorder	DISAM7J2	Disputed	Biomarker	[18]
Glaucoma/ocular hypertension	DISLBXBY	Limited	Altered Expression	[19]
Parkinson disease	DISQVHKL	Limited	Biomarker	[20]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[21]

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[22]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[23]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[24]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[25]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[26]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[27]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[28]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[29]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[30]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[31]
Menadione	DMSJDTY	Approved	Menadione affects the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[32]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[33]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[34]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[35]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[36]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[37]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[38]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[39]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[40]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[42]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of G-protein coupled receptor family C group 5 member C (GPRC5C).	[43]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of G-protein coupled receptor family C group 5 member C (GPRC5C).	[41]

References

• [1] An orphan G-protein-coupled receptor causes human gigantism and/or acromegaly: Molecular biology and clinical correlations.Best Pract Res Clin Endocrinol Metab. 2018 Apr;32(2):125-140. doi: 10.1016/j.beem.2018.02.004. Epub 2018 Mar 17.
• [2] Imipridone ONC212 activates orphan G protein-coupled receptor GPR132 and integrated stress response in acute myeloid leukemia.Leukemia. 2019 Dec;33(12):2805-2816. doi: 10.1038/s41375-019-0491-z. Epub 2019 May 24.
• [3] The orphan G protein-coupled receptor GPR55 promotes cancer cell proliferation via ERK.Oncogene. 2011 Jan 13;30(2):245-52. doi: 10.1038/onc.2010.402. Epub 2010 Sep 6.
• [4] The orphan G protein-coupled receptor 25 (GPR25) is activated by Apelin and Apela in non-mammalian vertebrates.Biochem Biophys Res Commun. 2018 Jun 22;501(2):408-414. doi: 10.1016/j.bbrc.2018.04.229. Epub 2018 May 11.
• [5] Orphan G protein-coupled receptor GPR56 plays a role in cell transformation and tumorigenesis involving the cell adhesion pathway.Mol Cancer Ther. 2007 Jun;6(6):1840-50. doi: 10.1158/1535-7163.MCT-07-0066.
• [6] Chemical genomic analysis of GPR35 signaling.Integr Biol (Camb). 2017 May 22;9(5):451-463. doi: 10.1039/c7ib00005g.
• [7] Immunohistochemical Expression of CD133 and LGR5 in Ulcerative Colitis-associated Colorectal Cancer and Dysplasia.In Vivo. 2019 Jul-Aug;33(4):1279-1284. doi: 10.21873/invivo.11600.
• [8] Differential expression of G-protein coupled receptor 56 in human esophageal squamous cell carcinoma.Cancer Lett. 2006 Feb 28;233(2):265-70. doi: 10.1016/j.canlet.2005.03.018.
• [9] Quantitative reverse transcriptase polymerase chain reaction analysis for KiSS-1 and orphan G-protein-coupled receptor (hOT7T175) gene expression in hepatocellular carcinoma.J Cancer Res Clin Oncol. 2003 Sep;129(9):531-5. doi: 10.1007/s00432-003-0469-z. Epub 2003 Jul 25.
• [10] Targeting Gpr52 lowers mutant HTT levels and rescues Huntington's disease-associated phenotypes.Brain. 2018 Jun 1;141(6):1782-1798. doi: 10.1093/brain/awy081.
• [11] Autosomal recessive woolly hair with hypotrichosis caused by a novel homozygous mutation in the P2RY5 gene.Exp Dermatol. 2009 Mar;18(3):218-21. doi: 10.1111/j.1600-0625.2008.00788.x. Epub 2008 Sep 18.
• [12] Apelin peptides block the entry of human immunodeficiency virus (HIV).FEBS Lett. 2000 May 4;473(1):15-8. doi: 10.1016/s0014-5793(00)01487-3.
• [13] Expression of G protein-coupled receptor 19 in human lung cancer cells is triggered by entry into S-phase and supports G(2)-M cell-cycle progression.Mol Cancer Res. 2012 Oct;10(10):1343-58. doi: 10.1158/1541-7786.MCR-12-0139. Epub 2012 Aug 21.
• [14] GPR50 is not associated with childhood-onset mood disorders in a large sample of Hungarian families.Psychiatr Genet. 2007 Dec;17(6):347-50. doi: 10.1097/YPG.0b013e3281ac232f.
• [15] GPRC5A is a potential oncogene in pancreatic ductal adenocarcinoma cells that is upregulated by gemcitabine with help from HuR.Cell Death Dis. 2016 Jul 14;7(7):e2294. doi: 10.1038/cddis.2016.169.
• [16] GPRC5D is a target for the immunotherapy of multiple myeloma with rationally designed CAR T cells. Sci Transl Med. 2019 Mar 27;11(485):eaau7746.
• [17] The orphan GPCR, GPR88, modulates function of the striatal dopamine system: a possible therapeutic target for psychiatric disorders?.Mol Cell Neurosci. 2009 Dec;42(4):438-47. doi: 10.1016/j.mcn.2009.09.007. Epub 2009 Sep 29.
• [18] Association of GPR50, an X-linked orphan G protein-coupled receptor, and affective disorder in an independent sample of the Scottish population.Neurosci Lett. 2010 May 21;475(3):169-73. doi: 10.1016/j.neulet.2010.03.072. Epub 2010 Apr 3.
• [19] Nonclassical Ligand-Independent Regulation of Go Protein by an Orphan Class C G-Protein-Coupled Receptor.Mol Pharmacol. 2019 Aug;96(2):233-246. doi: 10.1124/mol.118.113019. Epub 2019 Jun 12.
• [20] Induction of macroautophagy by overexpression of the Parkinson's disease-associated GPR37 receptor.FASEB J. 2009 Jun;23(6):1978-87. doi: 10.1096/fj.08-121210. Epub 2009 Feb 13.
• [21] Anti-diabetic action of all-trans retinoic acid and the orphan G protein coupled receptor GPRC5C in pancreatic -cells.Endocr J. 2017 Mar 31;64(3):325-338. doi: 10.1507/endocrj.EJ16-0338. Epub 2017 Feb 22.
• [22] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [23] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [24] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [25] Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
• [26] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [27] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [28] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [29] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [30] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [31] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [32] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [33] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [34] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [35] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [36] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [37] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [38] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [39] Synergistic effect of JQ1 and rapamycin for treatment of human osteosarcoma. Int J Cancer. 2015 May 1;136(9):2055-64.
• [40] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [41] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [42] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [43] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.