Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT93PQ6Y)

DOT Name Opioid-binding protein/cell adhesion molecule (OPCML)
Synonyms OBCAM; OPCML; Opioid-binding cell adhesion molecule; IgLON family member 1
Gene Name OPCML
Related Disease
Carcinoma ( )
Gastric neoplasm ( )
Glioma ( )
Prostate cancer ( )
Prostate carcinoma ( )
Bladder cancer ( )
Bladder transitional cell carcinoma ( )
Breast cancer ( )
Breast carcinoma ( )
Cholangiocarcinoma ( )
Congenital contractural arachnodactyly ( )
Epithelial ovarian cancer ( )
Esophageal squamous cell carcinoma ( )
Fatty liver disease ( )
Gallbladder disease ( )
Gastric cancer ( )
Hepatocellular carcinoma ( )
Major depressive disorder ( )
Non-small-cell lung cancer ( )
Osteoarthritis ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Stomach cancer ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Adenocarcinoma ( )
Advanced cancer ( )
Cervical carcinoma ( )
Classic Hodgkin lymphoma ( )
Lung adenocarcinoma ( )
Lung cancer ( )
Lymphoma ( )
Nasopharyngeal carcinoma ( )
Schizophrenia ( )
Adult glioblastoma ( )
Brain neoplasm ( )
Glioblastoma multiforme ( )
Metastatic malignant neoplasm ( )
Amyotrophic lateral sclerosis type 1 ( )
Neoplasm ( )
UniProt ID
OPCM_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
5UV6
Pfam ID
PF07679 ; PF00047 ; PF13927
Sequence
MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTID
DRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTD
NHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGF
VSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKG
ILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATN
KLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF
Function Binds opioids in the presence of acidic lipids; probably involved in cell contact.
Reactome Pathway
Post-translational modification (R-HSA-163125 )

Molecular Interaction Atlas (MIA) of This DOT

40 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Carcinoma DISH9F1N Definitive Biomarker [1]
Gastric neoplasm DISOKN4Y Definitive Altered Expression [2]
Glioma DIS5RPEH Definitive Altered Expression [3]
Prostate cancer DISF190Y Definitive Biomarker [4]
Prostate carcinoma DISMJPLE Definitive Biomarker [4]
Bladder cancer DISUHNM0 Strong Altered Expression [1]
Bladder transitional cell carcinoma DISNL46A Strong Biomarker [1]
Breast cancer DIS7DPX1 Strong Altered Expression [5]
Breast carcinoma DIS2UE88 Strong Altered Expression [5]
Cholangiocarcinoma DIS71F6X Strong Biomarker [6]
Congenital contractural arachnodactyly DISOM1K7 Strong Biomarker [6]
Epithelial ovarian cancer DIS56MH2 Strong Posttranslational Modification [7]
Esophageal squamous cell carcinoma DIS5N2GV Strong Altered Expression [8]
Fatty liver disease DIS485QZ Strong Altered Expression [9]
Gallbladder disease DISA6W3T Strong Altered Expression [6]
Gastric cancer DISXGOUK Strong Altered Expression [10]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [11]
Major depressive disorder DIS4CL3X Strong Genetic Variation [12]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [13]
Osteoarthritis DIS05URM Strong Genetic Variation [14]
Ovarian cancer DISZJHAP Strong Posttranslational Modification [15]
Ovarian neoplasm DISEAFTY Strong Posttranslational Modification [15]
Stomach cancer DISKIJSX Strong Altered Expression [10]
Urinary bladder cancer DISDV4T7 Strong Altered Expression [1]
Urinary bladder neoplasm DIS7HACE Strong Altered Expression [1]
Adenocarcinoma DIS3IHTY moderate Genetic Variation [16]
Advanced cancer DISAT1Z9 moderate Altered Expression [17]
Cervical carcinoma DIST4S00 moderate Biomarker [18]
Classic Hodgkin lymphoma DISV1LU6 moderate Posttranslational Modification [19]
Lung adenocarcinoma DISD51WR moderate Biomarker [16]
Lung cancer DISCM4YA moderate Genetic Variation [16]
Lymphoma DISN6V4S moderate Biomarker [19]
Nasopharyngeal carcinoma DISAOTQ0 moderate Biomarker [19]
Schizophrenia DISSRV2N moderate Biomarker [20]
Adult glioblastoma DISVP4LU Disputed Altered Expression [3]
Brain neoplasm DISY3EKS Disputed Biomarker [3]
Glioblastoma multiforme DISK8246 Disputed Altered Expression [3]
Metastatic malignant neoplasm DIS86UK6 Disputed Altered Expression [3]
Amyotrophic lateral sclerosis type 1 DIS5A2M0 Limited Genetic Variation [21]
Neoplasm DISZKGEW Limited Altered Expression [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 40 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Opioid-binding protein/cell adhesion molecule (OPCML). [22]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Opioid-binding protein/cell adhesion molecule (OPCML). [25]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Opioid-binding protein/cell adhesion molecule (OPCML). [31]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the methylation of Opioid-binding protein/cell adhesion molecule (OPCML). [32]
------------------------------------------------------------------------------------
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Opioid-binding protein/cell adhesion molecule (OPCML). [23]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Opioid-binding protein/cell adhesion molecule (OPCML). [24]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Opioid-binding protein/cell adhesion molecule (OPCML). [26]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Opioid-binding protein/cell adhesion molecule (OPCML). [27]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Opioid-binding protein/cell adhesion molecule (OPCML). [28]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Opioid-binding protein/cell adhesion molecule (OPCML). [29]
Niclosamide DMJAGXQ Approved Niclosamide increases the expression of Opioid-binding protein/cell adhesion molecule (OPCML). [30]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Opioid-binding protein/cell adhesion molecule (OPCML). [27]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Opioid-binding protein/cell adhesion molecule (OPCML). [33]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)

References

1 Prognostic value of opioid binding protein/cell adhesion molecule-like promoter methylation in bladder carcinoma.Eur J Cancer. 2011 May;47(7):1106-14. doi: 10.1016/j.ejca.2010.12.025. Epub 2011 Jan 25.
2 Comparison of gene expression profiles between primary tumor and metastatic lesions in gastric cancer patients using laser microdissection and cDNA microarray.World J Gastroenterol. 2006 Nov 21;12(43):6949-54. doi: 10.3748/wjg.v12.i43.6949.
3 Expression of cellular adhesion molecule 'OPCML' is down-regulated in gliomas and other brain tumours.Neuropathol Appl Neurobiol. 2007 Feb;33(1):77-85. doi: 10.1111/j.1365-2990.2006.00786.x.
4 Methylation profiling identified novel differentially methylated markers including OPCML and FLRT2 in prostate cancer.Epigenetics. 2016 Apr 2;11(4):247-58. doi: 10.1080/15592294.2016.1148867. Epub 2016 Feb 18.
5 The Tumor-Suppressor Protein OPCML Potentiates Anti-EGFR- and Anti-HER2-Targeted Therapy in HER2-Positive Ovarian and Breast Cancer.Mol Cancer Ther. 2017 Oct;16(10):2246-2256. doi: 10.1158/1535-7163.MCT-17-0081. Epub 2017 Aug 3.
6 Serum cell-free DNA methylation of OPCML and HOXD9 as a biomarker that may aid in differential diagnosis between cholangiocarcinoma and other biliary diseases.Clin Epigenetics. 2019 Mar 4;11(1):39. doi: 10.1186/s13148-019-0634-0.
7 Detection of OPCML methylation, a possible epigenetic marker, from free serum circulating DNA to improve the diagnosis of early-stage ovarian epithelial cancer.Oncol Lett. 2017 Jul;14(1):217-223. doi: 10.3892/ol.2017.6111. Epub 2017 May 3.
8 Epigenetic deregulations of Wnt/-catenin and transforming growth factor beta-Smad pathways in esophageal cancer: Outcome of DNA methylation.J Cancer Res Ther. 2019 Jan-Mar;15(1):192-203. doi: 10.4103/jcrt.JCRT_634_17.
9 Rhesus monkey model of liver disease reflecting clinical disease progression and hepatic gene expression analysis.Sci Rep. 2015 Oct 7;5:15019. doi: 10.1038/srep15019.
10 Down-regulated expression of OPCML predicts an unfavorable prognosis and promotes disease progression in human gastric cancer.BMC Cancer. 2017 Apr 14;17(1):268. doi: 10.1186/s12885-017-3203-y.
11 Meta-analysis of DNA methylation biomarkers in hepatocellular carcinoma.Oncotarget. 2016 Dec 6;7(49):81255-81267. doi: 10.18632/oncotarget.13221.
12 Genome-wide interaction study of a proxy for stress-sensitivity and its prediction of major depressive disorder.PLoS One. 2018 Dec 20;13(12):e0209160. doi: 10.1371/journal.pone.0209160. eCollection 2018.
13 Methylation of multiple genes as a candidate biomarker in non-small cell lung cancer.Cancer Lett. 2011 Apr 1;303(1):21-8. doi: 10.1016/j.canlet.2010.12.011. Epub 2011 Jan 20.
14 Identification of new susceptibility loci for osteoarthritis (arcOGEN): a genome-wide association study.Lancet. 2012 Sep 1;380(9844):815-23. doi: 10.1016/S0140-6736(12)60681-3. Epub 2012 Jul 3.
15 Methylation of OPCML promoter in ovarian cancer tissues predicts poor patient survival.Clin Chem Lab Med. 2014 May;52(5):735-42. doi: 10.1515/cclm-2013-0736.
16 Identification of a panel of sensitive and specific DNA methylation markers for lung adenocarcinoma.Mol Cancer. 2007 Oct 29;6:70. doi: 10.1186/1476-4598-6-70.
17 Loss of opioid binding protein/cell adhesion molecule-like gene expression in gastric cancer.Oncol Lett. 2018 Jun;15(6):9973-9977. doi: 10.3892/ol.2018.8562. Epub 2018 Apr 24.
18 OPCML gene promoter methylation and gene expression in tumor and stroma cells of invasive cervical carcinoma.Cancer Invest. 2008 Jul;26(6):569-74. doi: 10.1080/07357900701837044.
19 OPCML is a broad tumor suppressor for multiple carcinomas and lymphomas with frequently epigenetic inactivation.PLoS One. 2008 Aug 20;3(8):e2990. doi: 10.1371/journal.pone.0002990.
20 The Schizophrenia Susceptibility Gene OPCML Regulates Spine Maturation and Cognitive Behaviors through Eph-Cofilin Signaling.Cell Rep. 2019 Oct 1;29(1):49-61.e7. doi: 10.1016/j.celrep.2019.08.091.
21 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.Neurobiol Aging. 2014 Jul;35(7):1778.e9-1778.e23. doi: 10.1016/j.neurobiolaging.2014.01.014. Epub 2014 Jan 17.
22 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
23 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
24 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
25 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
26 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
27 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
28 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
29 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
30 Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
31 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
32 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
33 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.