Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9B7MX0)

• DOT Name: Transcription factor MafF (MAFF)
• Synonyms: U-Maf; V-maf musculoaponeurotic fibrosarcoma oncogene homolog F
• Gene Name: MAFF
• Related Disease:
  Alzheimer disease
  Juvenile idiopathic arthritis
  Parkinson disease
  Plasma cell myeloma
  Hepatocellular carcinoma
• UniProt ID: MAFF_HUMAN
• Pfam ID: PF03131
• Sequence:
  MSVDPLSSKALKIKRELSENTPHLSDEALMGLSVRELNRHLRGLSAEEVTRLKQRRRTLK
  NRGYAASCRVKRVCQKEELQKQKSELEREVDKLARENAAMRLELDALRGKCEALQGFARS
  VAAARGPATLVAPASVITIVKSTPGSGSGPAHGPDPAHGPASCS
• Function: Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins, such as NFE2L1/NRF1, and recruiting them to specific DNA-binding sites. Interacts with the upstream promoter region of the oxytocin receptor gene. May be a transcriptional enhancer in the up-regulation of the oxytocin receptor gene at parturition.
• Tissue Specificity: Expressed in the term myometrium and kidney.
• Reactome Pathway: Factors involved in megakaryocyte development and platelet production (R-HSA-983231)

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Alzheimer disease	DISF8S70	Strong	Biomarker	[1]
Juvenile idiopathic arthritis	DISQZGBV	Strong	Biomarker	[2]
Parkinson disease	DISQVHKL	Strong	Biomarker	[1]
Plasma cell myeloma	DIS0DFZ0	moderate	Genetic Variation	[3]
Hepatocellular carcinoma	DIS0J828	Limited	Altered Expression	[4]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Transcription factor MafF (MAFF) affects the response to substance of Fluorouracil.	[49]
Mitoxantrone	DMM39BF	Approved	Transcription factor MafF (MAFF) affects the response to substance of Mitoxantrone.	[50]

54 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Transcription factor MafF (MAFF).	[5]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Transcription factor MafF (MAFF).	[6]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Transcription factor MafF (MAFF).	[7]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Transcription factor MafF (MAFF).	[8]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Transcription factor MafF (MAFF).	[9]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Transcription factor MafF (MAFF).	[10]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Transcription factor MafF (MAFF).	[12]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Transcription factor MafF (MAFF).	[13]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Transcription factor MafF (MAFF).	[14]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Transcription factor MafF (MAFF).	[15]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Transcription factor MafF (MAFF).	[16]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Transcription factor MafF (MAFF).	[15]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Transcription factor MafF (MAFF).	[17]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Transcription factor MafF (MAFF).	[18]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Transcription factor MafF (MAFF).	[19]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Transcription factor MafF (MAFF).	[20]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Transcription factor MafF (MAFF).	[14]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of Transcription factor MafF (MAFF).	[10]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Transcription factor MafF (MAFF).	[21]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Transcription factor MafF (MAFF).	[22]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Transcription factor MafF (MAFF).	[23]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Transcription factor MafF (MAFF).	[24]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Transcription factor MafF (MAFF).	[25]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Transcription factor MafF (MAFF).	[26]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Transcription factor MafF (MAFF).	[27]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol affects the expression of Transcription factor MafF (MAFF).	[28]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid increases the expression of Transcription factor MafF (MAFF).	[29]
Nefazodone	DM4ZS8M	Approved	Nefazodone increases the expression of Transcription factor MafF (MAFF).	[30]
Bexarotene	DMOBIKY	Approved	Bexarotene decreases the expression of Transcription factor MafF (MAFF).	[31]
Atazanavir	DMSYRBX	Approved	Atazanavir increases the expression of Transcription factor MafF (MAFF).	[30]
Salicyclic acid	DM2F8XZ	Approved	Salicyclic acid increases the expression of Transcription factor MafF (MAFF).	[27]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Transcription factor MafF (MAFF).	[32]
Rigosertib	DMOSTXF	Phase 3	Rigosertib increases the expression of Transcription factor MafF (MAFF).	[33]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Transcription factor MafF (MAFF).	[34]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Transcription factor MafF (MAFF).	[35]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of Transcription factor MafF (MAFF).	[27]
Disulfiram	DMCL2OK	Phase 2 Trial	Disulfiram increases the expression of Transcription factor MafF (MAFF).	[36]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Transcription factor MafF (MAFF).	[38]
Eugenol	DM7US1H	Patented	Eugenol increases the expression of Transcription factor MafF (MAFF).	[36]
Benzylcinnamate	DMD7Z3H	Patented	Benzylcinnamate increases the expression of Transcription factor MafF (MAFF).	[27]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Transcription factor MafF (MAFF).	[41]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Transcription factor MafF (MAFF).	[42]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Transcription factor MafF (MAFF).	[43]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Transcription factor MafF (MAFF).	[44]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Transcription factor MafF (MAFF).	[45]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Transcription factor MafF (MAFF).	[46]
geraniol	DMS3CBD	Investigative	geraniol increases the expression of Transcription factor MafF (MAFF).	[47]
Arachidonic acid	DMUOQZD	Investigative	Arachidonic acid increases the expression of Transcription factor MafF (MAFF).	[48]
Benzoquinone	DMNBA0G	Investigative	Benzoquinone increases the expression of Transcription factor MafF (MAFF).	[27]
citral	DM53ZGY	Investigative	citral increases the expression of Transcription factor MafF (MAFF).	[27]
hydroxycitronellal	DMFHCV9	Investigative	hydroxycitronellal increases the expression of Transcription factor MafF (MAFF).	[27]
GW-788388	DMIBUW5	Investigative	GW-788388 decreases the expression of Transcription factor MafF (MAFF).	[35]
Perillaldehyde	DMZA0VD	Investigative	Perillaldehyde increases the expression of Transcription factor MafF (MAFF).	[27]
1-Phenyl-propane-1,2-dione	DM04SWY	Investigative	1-Phenyl-propane-1,2-dione increases the expression of Transcription factor MafF (MAFF).	[27]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic increases the methylation of Transcription factor MafF (MAFF).	[11]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Transcription factor MafF (MAFF).	[37]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Transcription factor MafF (MAFF).	[39]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Transcription factor MafF (MAFF).	[40]

References

• [1] Meta-Analysis of Parkinson's Disease and Alzheimer's Disease Revealed Commonly Impaired Pathways and Dysregulation of NRF2-Dependent Genes.J Alzheimers Dis. 2017;56(4):1525-1539. doi: 10.3233/JAD-161032.
• [2] Gene expression signatures in polyarticular juvenile idiopathic arthritis demonstrate disease heterogeneity and offer a molecular classification of disease subsets.Arthritis Rheum. 2009 Jul;60(7):2113-23. doi: 10.1002/art.24534.
• [3] The multiple myeloma risk allele at 5q15 lowers ELL2 expression and increases ribosomal gene expression.Nat Commun. 2018 Apr 25;9(1):1649. doi: 10.1038/s41467-018-04082-2.
• [4] Involvement of MAFB and MAFF in Retinoid-Mediated Suppression of Hepatocellular Carcinoma Invasion.Int J Mol Sci. 2018 May 13;19(5):1450. doi: 10.3390/ijms19051450.
• [5] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [6] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [7] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [8] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [9] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [10] Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
• [11] Identification of novel gene targets and putative regulators of arsenic-associated DNA methylation in human urothelial cells and bladder cancer. Chem Res Toxicol. 2015 Jun 15;28(6):1144-55. doi: 10.1021/tx500393y. Epub 2015 Jun 3.
• [12] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [13] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [14] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [15] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [16] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [17] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [18] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [19] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [20] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [21] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [22] Cannabidiol induces antioxidant pathways in keratinocytes by targeting BACH1. Redox Biol. 2020 Jan;28:101321. doi: 10.1016/j.redox.2019.101321. Epub 2019 Sep 5.
• [23] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [24] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [25] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [26] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [27] A new in vitro method for identifying chemical sensitizers combining peptide binding with ARE/EpRE-mediated gene expression in human skin cells. Cutan Ocul Toxicol. 2010 Sep;29(3):171-92.
• [28] The genomic response of Ishikawa cells to bisphenol A exposure is dose- and time-dependent. Toxicology. 2010 Apr 11;270(2-3):137-49. doi: 10.1016/j.tox.2010.02.008. Epub 2010 Feb 17.
• [29] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [30] Robustness testing and optimization of an adverse outcome pathway on cholestatic liver injury. Arch Toxicol. 2020 Apr;94(4):1151-1172. doi: 10.1007/s00204-020-02691-9. Epub 2020 Mar 10.
• [31] Identification of biomarkers modulated by the rexinoid LGD1069 (bexarotene) in human breast cells using oligonucleotide arrays. Cancer Res. 2006 Dec 15;66(24):12009-18.
• [32] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [33] ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
• [34] Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
• [35] Capturing time-dependent activation of genes and stress-response pathways using transcriptomics in iPSC-derived renal proximal tubule cells. Cell Biol Toxicol. 2023 Aug;39(4):1773-1793. doi: 10.1007/s10565-022-09783-5. Epub 2022 Dec 31.
• [36] Keratinocyte gene expression profiles discriminate sensitizing and irritating compounds. Toxicol Sci. 2010 Sep;117(1):81-9.
• [37] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [38] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [39] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [40] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [41] Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.
• [42] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [43] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [44] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [45] An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.
• [46] Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
• [47] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [48] Arachidonic acid-induced gene expression in colon cancer cells. Carcinogenesis. 2006 Oct;27(10):1950-60.
• [49] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [50] Prediction of doxorubicin sensitivity in breast tumors based on gene expression profiles of drug-resistant cell lines correlates with patient survival. Oncogene. 2005 Nov 17;24(51):7542-51. doi: 10.1038/sj.onc.1208908.