Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9PK2SI)

DOT Name Fibroblast growth factor 3 (FGF3)
Synonyms FGF-3; Heparin-binding growth factor 3; HBGF-3; Proto-oncogene Int-2
Gene Name FGF3
Related Disease
Advanced cancer ( )
B-cell neoplasm ( )
Carcinoma of esophagus ( )
Deafness with labyrinthine aplasia, microtia, and microdontia ( )
Epithelial ovarian cancer ( )
Esophageal cancer ( )
Multiple endocrine neoplasia type 1 ( )
Adenoma ( )
Bladder cancer ( )
Breast neoplasm ( )
Colon carcinoma ( )
Deafness ( )
Endometrial carcinoma ( )
Endometrium adenocarcinoma ( )
Esophageal squamous cell carcinoma ( )
Head and neck cancer ( )
Head and neck carcinoma ( )
Head-neck squamous cell carcinoma ( )
Hepatocellular carcinoma ( )
Isolated cleft lip ( )
Isolated cleft palate ( )
Kaposi sarcoma ( )
Laryngeal squamous cell carcinoma ( )
Lung carcinoma ( )
Metastatic malignant neoplasm ( )
Myelodysplastic syndrome ( )
Oral cancer ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Squamous cell carcinoma ( )
Thyroid cancer ( )
Thyroid gland carcinoma ( )
Thyroid tumor ( )
Tooth agenesis ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Melanoma ( )
Type-1 diabetes ( )
Neoplasm of esophagus ( )
Acute myelogenous leukaemia ( )
Colorectal carcinoma ( )
Endometrial cancer ( )
Myelofibrosis ( )
Nasopharyngeal carcinoma ( )
Primary myelofibrosis ( )
Sensorineural hearing loss disorder ( )
UniProt ID
FGF3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00167
Sequence
MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP
SGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVER
IHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLP
RVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH
Function Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal ear development.
KEGG Pathway
MAPK sig.ling pathway (hsa04010 )
Ras sig.ling pathway (hsa04014 )
Rap1 sig.ling pathway (hsa04015 )
Calcium sig.ling pathway (hsa04020 )
PI3K-Akt sig.ling pathway (hsa04151 )
Regulation of actin cytoskeleton (hsa04810 )
Pathways in cancer (hsa05200 )
Chemical carcinogenesis - receptor activation (hsa05207 )
Melanoma (hsa05218 )
Breast cancer (hsa05224 )
Gastric cancer (hsa05226 )
Reactome Pathway
(FGFR2 )
PIP3 activates AKT signaling (R-HSA-1257604 )
FGFR1b ligand binding and activation (R-HSA-190370 )
FGFR2b ligand binding and activation (R-HSA-190377 )
Activated point mutants of FGFR2 (R-HSA-2033519 )
Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530 )
Phospholipase C-mediated cascade (R-HSA-5654219 )
Phospholipase C-mediated cascade (R-HSA-5654221 )
Downstream signaling of activated FGFR1 (R-HSA-5654687 )
SHC-mediated cascade (R-HSA-5654688 )
PI-3K cascade (R-HSA-5654689 )
FRS-mediated FGFR1 signaling (R-HSA-5654693 )
PI-3K cascade (R-HSA-5654695 )
SHC-mediated cascade (R-HSA-5654699 )
FRS-mediated FGFR2 signaling (R-HSA-5654700 )
Negative regulation of FGFR1 signaling (R-HSA-5654726 )
Negative regulation of FGFR2 signaling (R-HSA-5654727 )
Signaling by FGFR2 in disease (R-HSA-5655253 )
FGFRL1 modulation of FGFR1 signaling (R-HSA-5658623 )
RAF/MAP kinase cascade (R-HSA-5673001 )
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558 )
PI3K Cascade (R-HSA-109704 )

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Definitive Biomarker [1]
B-cell neoplasm DISVY326 Definitive Genetic Variation [2]
Carcinoma of esophagus DISS6G4D Definitive Biomarker [3]
Deafness with labyrinthine aplasia, microtia, and microdontia DISD2I4K Definitive Autosomal recessive [4]
Epithelial ovarian cancer DIS56MH2 Definitive Biomarker [5]
Esophageal cancer DISGB2VN Definitive Biomarker [3]
Multiple endocrine neoplasia type 1 DIS0RJRK Definitive Biomarker [6]
Adenoma DIS78ZEV Strong Altered Expression [7]
Bladder cancer DISUHNM0 Strong Biomarker [8]
Breast neoplasm DISNGJLM Strong Biomarker [9]
Colon carcinoma DISJYKUO Strong Altered Expression [10]
Deafness DISKCLH4 Strong Biomarker [11]
Endometrial carcinoma DISXR5CY Strong Genetic Variation [12]
Endometrium adenocarcinoma DISY6744 Strong Biomarker [13]
Esophageal squamous cell carcinoma DIS5N2GV Strong Biomarker [14]
Head and neck cancer DISBPSQZ Strong Biomarker [15]
Head and neck carcinoma DISOU1DS Strong Biomarker [15]
Head-neck squamous cell carcinoma DISF7P24 Strong Biomarker [16]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [17]
Isolated cleft lip DIS2O2JV Strong Biomarker [18]
Isolated cleft palate DISV80CD Strong Biomarker [19]
Kaposi sarcoma DISC1H1Z Strong Biomarker [20]
Laryngeal squamous cell carcinoma DIS9UUVF Strong Altered Expression [21]
Lung carcinoma DISTR26C Strong Altered Expression [22]
Metastatic malignant neoplasm DIS86UK6 Strong Altered Expression [23]
Myelodysplastic syndrome DISYHNUI Strong Genetic Variation [24]
Oral cancer DISLD42D Strong Biomarker [25]
Ovarian cancer DISZJHAP Strong Genetic Variation [5]
Ovarian neoplasm DISEAFTY Strong Biomarker [13]
Squamous cell carcinoma DISQVIFL Strong Genetic Variation [26]
Thyroid cancer DIS3VLDH Strong Biomarker [27]
Thyroid gland carcinoma DISMNGZ0 Strong Biomarker [27]
Thyroid tumor DISLVKMD Strong Biomarker [27]
Tooth agenesis DIS1PWC7 Strong Genetic Variation [28]
Urinary bladder cancer DISDV4T7 Strong Biomarker [8]
Urinary bladder neoplasm DIS7HACE Strong Biomarker [8]
Melanoma DIS1RRCY moderate Biomarker [29]
Type-1 diabetes DIS7HLUB moderate Genetic Variation [30]
Neoplasm of esophagus DISOLKAQ Disputed Biomarker [3]
Acute myelogenous leukaemia DISCSPTN Limited Genetic Variation [31]
Colorectal carcinoma DIS5PYL0 Limited Genetic Variation [32]
Endometrial cancer DISW0LMR Limited Genetic Variation [33]
Myelofibrosis DISIMP21 Limited Biomarker [34]
Nasopharyngeal carcinoma DISAOTQ0 Limited Biomarker [35]
Primary myelofibrosis DIS6L0CN Limited Biomarker [34]
Sensorineural hearing loss disorder DISJV45Z Limited Biomarker [36]
------------------------------------------------------------------------------------
⏷ Show the Full List of 46 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Fibroblast growth factor 3 (FGF3). [37]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Fibroblast growth factor 3 (FGF3). [38]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Fibroblast growth factor 3 (FGF3). [39]
Taxifolin DMQJSF9 Preclinical Taxifolin decreases the expression of Fibroblast growth factor 3 (FGF3). [40]
------------------------------------------------------------------------------------

References

1 11q13 allelic imbalance discriminates pulmonary carcinoids from tumorlets. A microdissection-based genotyping approach useful in clinical practice.Am J Pathol. 1999 Aug;155(2):633-40. doi: 10.1016/S0002-9440(10)65159-0.
2 WNT and FGF gene clusters (review).Int J Oncol. 2002 Dec;21(6):1269-73.
3 Gene amplification of int-2 and erbB in human esophageal cancer: relationship to clinicopathological variables.Cancer Invest. 1997;15(5):411-5. doi: 10.3109/07357909709047579.
4 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
5 Detection of c-erbB-2 and FGF-3 (INT-2) gene amplification in epithelial ovarian cancer.Int J Oncol. 2000 Jul;17(1):103-6. doi: 10.3892/ijo.17.1.103.
6 Linkage analysis of 7 polymorphic markers at chromosome 11p11.2-11q13 in 27 multiple endocrine neoplasia type 1 families.Ann Hum Genet. 1993 Jan;57(1):17-25. doi: 10.1111/j.1469-1809.1993.tb00883.x.
7 Molecular screening of pituitary adenomas for gene mutations and rearrangements.J Clin Endocrinol Metab. 1993 Jul;77(1):50-5. doi: 10.1210/jcem.77.1.8100831.
8 The evolving understanding of microRNA in bladder cancer.Urol Oncol. 2014 Jan;32(1):41.e31-40. doi: 10.1016/j.urolonc.2013.04.014. Epub 2013 Aug 2.
9 Discovery of 3-(2,6-dichloro-3,5-dimethoxy-phenyl)-1-{6-[4-(4-ethyl-piperazin-1-yl)-phenylamino]-pyrimidin-4-yl}-1-methyl-urea (NVP-BGJ398), a potent and selective inhibitor of the fibroblast growth factor receptor family of receptor tyrosine kinase. J Med Chem. 2011 Oct 27;54(20):7066-83. doi: 10.1021/jm2006222. Epub 2011 Sep 21.
10 Regulation of FGF-3 gene expression in tumorigenic and non-tumorigenic clones of a human colon carcinoma cell line.J Biol Chem. 2000 Jun 9;275(23):17364-73. doi: 10.1074/jbc.M909316199.
11 Potential oncogene product related to growth factors.Nature. 1987 Apr 30-May 6;326(6116):833. doi: 10.1038/326833a0.
12 The coexistence of ERBB2, INT2, and CMYC oncogene amplifications and PTEN gene mutations in endometrial carcinoma.J Cancer Res Clin Oncol. 2004 Feb;130(2):114-21. doi: 10.1007/s00432-003-0518-7. Epub 2003 Dec 9.
13 Detection of c-erbB-2/neu and fibroblast growth factor-3/INT-2 but not epidermal growth factor receptor gene amplification in endometrial cancer by differential polymerase chain reaction.Cancer. 1995 Apr 15;75(8):2139-46. doi: 10.1002/1097-0142(19950415)75:8<2139::aid-cncr2820750817>3.0.co;2-6.
14 Inhibitory effects of Gleditsia sinensis fruit extract on telomerase activity and oncogenic expression in human esophageal squamous cell carcinoma.Int J Mol Med. 2007 Jun;19(6):953-60.
15 Hypomethylated Fgf3 is a potential biomarker for early detection of oral cancer in mice treated with the tobacco carcinogen dibenzo[def,p]chrysene.PLoS One. 2017 Oct 26;12(10):e0186873. doi: 10.1371/journal.pone.0186873. eCollection 2017.
16 Visualization of the timing of gene amplification during multistep head and neck tumorigenesis.Cancer Res. 2000 Nov 15;60(22):6496-502.
17 Exome sequencing of hepatocellular carcinomas identifies new mutational signatures and potential therapeutic targets. Nat Genet. 2015 May;47(5):505-511. doi: 10.1038/ng.3252. Epub 2015 Mar 30.
18 Impaired FGF signaling contributes to cleft lip and palate. Proc Natl Acad Sci U S A. 2007 Mar 13;104(11):4512-7. doi: 10.1073/pnas.0607956104. Epub 2007 Mar 6.
19 Sequence evaluation of FGF and FGFR gene conserved non-coding elements in non-syndromic cleft lip and palate cases.Am J Med Genet A. 2007 Dec 15;143A(24):3228-34. doi: 10.1002/ajmg.a.31965.
20 FGF4 and INT2 oncogenes are amplified and expressed in Kaposi's sarcoma.Mod Pathol. 2000 Apr;13(4):433-7. doi: 10.1038/modpathol.3880074.
21 Clinical significance of Cyclin D1, FGF3 and p21 protein expression in laryngeal squamous cell carcinoma.J BUON. 2014 Oct-Dec;19(4):944-52.
22 Co-overexpression of fibroblast growth factor 3 and epidermal growth factor receptor is correlated with the development of nonsmall cell lung carcinoma.Cancer. 2006 Jan 1;106(1):146-55. doi: 10.1002/cncr.21581.
23 Up-regulation of fibroblast growth factor 3 is associated with tumor metastasis and recurrence in human hepatocellular carcinoma.Cancer Lett. 2007 Jul 8;252(1):36-42. doi: 10.1016/j.canlet.2006.12.003. Epub 2007 Jan 9.
24 MDS shows a higher expression of hTERT and alternative splice variants in unactivated T-cells.Oncotarget. 2016 Nov 1;7(44):71904-71914. doi: 10.18632/oncotarget.12115.
25 Inhibitory effects of int-2 gene on the invasion and metastasis of oral cancer cells.Eur Rev Med Pharmacol Sci. 2017 Dec;21(24):5677-5682. doi: 10.26355/eurrev_201712_14012.
26 First hints for a correlation between amplification of the Int-2 gene and infection with human papillomavirus in head and neck squamous cell carcinomas.J Oral Pathol Med. 2000 Oct;29(9):432-7. doi: 10.1034/j.1600-0714.2000.290903.x.
27 INT-2 gene amplification in differentiated human thyroid cancer.Exp Clin Endocrinol Diabetes. 1996;104 Suppl 4:101-4. doi: 10.1055/s-0029-1211713.
28 Gene defect in hypodontia: exclusion of EGF, EGFR, and FGF-3 as candidate genes.J Dent Res. 1996 Jun;75(6):1346-52. doi: 10.1177/00220345960750060401.
29 Disruption of the protein interaction between FAK and IGF-1R inhibits melanoma tumor growth.Cell Cycle. 2012 Sep 1;11(17):3250-9. doi: 10.4161/cc.21611. Epub 2012 Aug 16.
30 Genetic mapping of a susceptibility locus for insulin-dependent diabetes mellitus on chromosome 11q.Nature. 1994 Sep 8;371(6493):161-4. doi: 10.1038/371161a0.
31 International scoring system for evaluating prognosis in myelodysplastic syndromes.Blood. 1997 Mar 15;89(6):2079-88.
32 High incidence of coamplification of hst-1 and int-2 genes in human esophageal carcinomas.Cancer Res. 1989 Oct 15;49(20):5505-8.
33 Mutations and amplification of oncogenes in endometrial cancer.Oncology. 1999;56(1):59-65. doi: 10.1159/000011931.
34 Genetically inspired prognostic scoring system (GIPSS) outperforms dynamic international prognostic scoring system (DIPSS) in myelofibrosis patients.Am J Hematol. 2019 Jan;94(1):87-92. doi: 10.1002/ajh.25335. Epub 2018 Nov 25.
35 Frequent c-myc and Int-2 overrepresentations in nasopharyngeal carcinoma.Hum Pathol. 2000 Feb;31(2):169-78. doi: 10.1016/s0046-8177(00)80216-6.
36 SNP genome scanning localizes oto-dental syndrome to chromosome 11q13 and microdeletions at this locus implicate FGF3 in dental and inner-ear disease and FADD in ocular coloboma.Hum Mol Genet. 2007 Oct 15;16(20):2482-93. doi: 10.1093/hmg/ddm204. Epub 2007 Jul 25.
37 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
38 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
39 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
40 The chemopreventive effect of taxifolin is exerted through ARE-dependent gene regulation. Biol Pharm Bull. 2007 Jun;30(6):1074-9.