Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB1073G)

DOT Name Stearoyl-CoA desaturase (SCD)
Synonyms hSCD1; EC 1.14.19.1; Acyl-CoA desaturase; Delta(9)-desaturase; Delta-9 desaturase; Fatty acid desaturase
Gene Name SCD
UniProt ID
SCD_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
4ZYO
EC Number
1.14.19.1
Sequence
MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYK
DKEGPSPKVEYVWRNIILMSLLHLGALYGITLIPTCKFYTWLWGVFYYFVSALGITAGAH
RLWSHRSYKARLPLRLFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFS
HVGWLLVRKHPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWGE
TFQNSVFVATFLRYAVVLNATWLVNSAAHLFGYRPYDKNISPRENILVSLGAVGEGFHNY
HHSFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAILARIKRTGDGNYKSG
Function
Stearoyl-CoA desaturase that utilizes O(2) and electrons from reduced cytochrome b5 to introduce the first double bond into saturated fatty acyl-CoA substrates. Catalyzes the insertion of a cis double bond at the delta-9 position into fatty acyl-CoA substrates including palmitoyl-CoA and stearoyl-CoA. Gives rise to a mixture of 16:1 and 18:1 unsaturated fatty acids. Plays an important role in lipid biosynthesis. Plays an important role in regulating the expression of genes that are involved in lipogenesis and in regulating mitochondrial fatty acid oxidation. Plays an important role in body energy homeostasis. Contributes to the biosynthesis of membrane phospholipids, cholesterol esters and triglycerides.
Tissue Specificity Detected in fetal liver, lung and brain. Highly expressed in adult adipose tissue, and at lower levels in adult brain and lung.
KEGG Pathway
Biosynthesis of unsaturated fatty acids (hsa01040 )
Metabolic pathways (hsa01100 )
Fatty acid metabolism (hsa01212 )
PPAR sig.ling pathway (hsa03320 )
AMPK sig.ling pathway (hsa04152 )
Alcoholic liver disease (hsa04936 )
Reactome Pathway
Fatty acyl-CoA biosynthesis (R-HSA-75105 )
NR1H2 & NR1H3 regulate gene expression linked to lipogenesis (R-HSA-9029558 )
Activation of gene expression by SREBF (SREBP) (R-HSA-2426168 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Topotecan DMP6G8T Approved Stearoyl-CoA desaturase (SCD) affects the response to substance of Topotecan. [62]
Mitoxantrone DMM39BF Approved Stearoyl-CoA desaturase (SCD) affects the response to substance of Mitoxantrone. [62]
------------------------------------------------------------------------------------
84 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Stearoyl-CoA desaturase (SCD). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Stearoyl-CoA desaturase (SCD). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Stearoyl-CoA desaturase (SCD). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Stearoyl-CoA desaturase (SCD). [4]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Stearoyl-CoA desaturase (SCD). [5]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Stearoyl-CoA desaturase (SCD). [6]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Stearoyl-CoA desaturase (SCD). [7]
Quercetin DM3NC4M Approved Quercetin affects the expression of Stearoyl-CoA desaturase (SCD). [8]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Stearoyl-CoA desaturase (SCD). [9]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Stearoyl-CoA desaturase (SCD). [10]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Stearoyl-CoA desaturase (SCD). [11]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Stearoyl-CoA desaturase (SCD). [12]
Carbamazepine DMZOLBI Approved Carbamazepine decreases the expression of Stearoyl-CoA desaturase (SCD). [13]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Stearoyl-CoA desaturase (SCD). [14]
Phenobarbital DMXZOCG Approved Phenobarbital increases the expression of Stearoyl-CoA desaturase (SCD). [15]
Progesterone DMUY35B Approved Progesterone increases the expression of Stearoyl-CoA desaturase (SCD). [16]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of Stearoyl-CoA desaturase (SCD). [17]
Bortezomib DMNO38U Approved Bortezomib decreases the expression of Stearoyl-CoA desaturase (SCD). [18]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol increases the expression of Stearoyl-CoA desaturase (SCD). [19]
Rosiglitazone DMILWZR Approved Rosiglitazone increases the expression of Stearoyl-CoA desaturase (SCD). [20]
Ethanol DMDRQZU Approved Ethanol increases the expression of Stearoyl-CoA desaturase (SCD). [21]
Testosterone enanthate DMB6871 Approved Testosterone enanthate affects the expression of Stearoyl-CoA desaturase (SCD). [22]
Nicotine DMWX5CO Approved Nicotine increases the expression of Stearoyl-CoA desaturase (SCD). [23]
Piroxicam DMTK234 Approved Piroxicam decreases the expression of Stearoyl-CoA desaturase (SCD). [24]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of Stearoyl-CoA desaturase (SCD). [25]
Clozapine DMFC71L Approved Clozapine increases the expression of Stearoyl-CoA desaturase (SCD). [26]
Indomethacin DMSC4A7 Approved Indomethacin increases the expression of Stearoyl-CoA desaturase (SCD). [27]
Gemcitabine DMSE3I7 Approved Gemcitabine increases the expression of Stearoyl-CoA desaturase (SCD). [28]
Alitretinoin DMME8LH Approved Alitretinoin increases the expression of Stearoyl-CoA desaturase (SCD). [29]
Haloperidol DM96SE0 Approved Haloperidol increases the expression of Stearoyl-CoA desaturase (SCD). [26]
Ursodeoxycholic acid DMCUT21 Approved Ursodeoxycholic acid decreases the expression of Stearoyl-CoA desaturase (SCD). [30]
Fluoxetine DM3PD2C Approved Fluoxetine increases the expression of Stearoyl-CoA desaturase (SCD). [31]
Rofecoxib DM3P5DA Approved Rofecoxib increases the expression of Stearoyl-CoA desaturase (SCD). [32]
Bexarotene DMOBIKY Approved Bexarotene increases the expression of Stearoyl-CoA desaturase (SCD). [33]
Mitotane DMU1GX0 Approved Mitotane decreases the expression of Stearoyl-CoA desaturase (SCD). [34]
Fructose DM43AN2 Approved Fructose increases the expression of Stearoyl-CoA desaturase (SCD). [35]
Clavulanate DM2FGRT Approved Clavulanate decreases the expression of Stearoyl-CoA desaturase (SCD). [36]
Imipramine DM2NUH3 Approved Imipramine increases the expression of Stearoyl-CoA desaturase (SCD). [31]
Vandetanib DMRICNP Approved Vandetanib increases the expression of Stearoyl-CoA desaturase (SCD). [37]
Clomipramine DMINRKW Approved Clomipramine increases the expression of Stearoyl-CoA desaturase (SCD). [31]
Citalopram DM2G9AE Approved Citalopram increases the expression of Stearoyl-CoA desaturase (SCD). [31]
Clopidogrel DMOL54H Approved Clopidogrel decreases the expression of Stearoyl-CoA desaturase (SCD). [34]
Bupropion DM5PCS7 Approved Bupropion increases the expression of Stearoyl-CoA desaturase (SCD). [31]
OPC-34712 DMHG57U Approved OPC-34712 decreases the expression of Stearoyl-CoA desaturase (SCD). [38]
Mirtazapine DML53ZJ Approved Mirtazapine increases the expression of Stearoyl-CoA desaturase (SCD). [31]
Isoflavone DM7U58J Phase 4 Isoflavone increases the expression of Stearoyl-CoA desaturase (SCD). [39]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Stearoyl-CoA desaturase (SCD). [11]
Tamibarotene DM3G74J Phase 3 Tamibarotene affects the expression of Stearoyl-CoA desaturase (SCD). [3]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of Stearoyl-CoA desaturase (SCD). [40]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of Stearoyl-CoA desaturase (SCD). [41]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Stearoyl-CoA desaturase (SCD). [13]
PEITC DMOMN31 Phase 2 PEITC decreases the expression of Stearoyl-CoA desaturase (SCD). [42]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Stearoyl-CoA desaturase (SCD). [2]
IRX4204 DM9SCME Phase 1 IRX4204 increases the expression of Stearoyl-CoA desaturase (SCD). [29]
Clemizole DM4UAPD Phase 1 Clemizole decreases the expression of Stearoyl-CoA desaturase (SCD). [34]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Stearoyl-CoA desaturase (SCD). [43]
Ferulic Acid DMJC7NF Patented Ferulic Acid decreases the expression of Stearoyl-CoA desaturase (SCD). [40]
LG100268 DM41RK2 Discontinued in Phase 1 LG100268 increases the expression of Stearoyl-CoA desaturase (SCD). [33]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Stearoyl-CoA desaturase (SCD). [45]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Stearoyl-CoA desaturase (SCD). [11]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Stearoyl-CoA desaturase (SCD). [46]
Coumestrol DM40TBU Investigative Coumestrol increases the expression of Stearoyl-CoA desaturase (SCD). [47]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of Stearoyl-CoA desaturase (SCD). [36]
chloropicrin DMSGBQA Investigative chloropicrin decreases the expression of Stearoyl-CoA desaturase (SCD). [48]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Stearoyl-CoA desaturase (SCD). [49]
Paraquat DMR8O3X Investigative Paraquat decreases the expression of Stearoyl-CoA desaturase (SCD). [50]
Hexadecanoic acid DMWUXDZ Investigative Hexadecanoic acid increases the expression of Stearoyl-CoA desaturase (SCD). [51]
Arachidonic acid DMUOQZD Investigative Arachidonic acid increases the expression of Stearoyl-CoA desaturase (SCD). [52]
ELLAGIC ACID DMX8BS5 Investigative ELLAGIC ACID decreases the expression of Stearoyl-CoA desaturase (SCD). [40]
Chrysin DM7V2LG Investigative Chrysin decreases the expression of Stearoyl-CoA desaturase (SCD). [40]
Oleic acid DM54O1Z Investigative Oleic acid decreases the expression of Stearoyl-CoA desaturase (SCD). [53]
GW7647 DM9RD0C Investigative GW7647 increases the expression of Stearoyl-CoA desaturase (SCD). [53]
GW-3965 DMG60ET Investigative GW-3965 increases the expression of Stearoyl-CoA desaturase (SCD). [54]
Linoleic acid DMDGPY9 Investigative Linoleic acid increases the expression of Stearoyl-CoA desaturase (SCD). [52]
T0901317 DMZQVDI Investigative T0901317 increases the expression of Stearoyl-CoA desaturase (SCD). [55]
NMS-873 DMYKZ6U Investigative NMS-873 decreases the expression of Stearoyl-CoA desaturase (SCD). [56]
BETULIN DMGQRON Investigative BETULIN decreases the expression of Stearoyl-CoA desaturase (SCD). [57]
TTNPB DMSABD0 Investigative TTNPB increases the expression of Stearoyl-CoA desaturase (SCD). [29]
Ganoderic acid A DM42EVG Investigative Ganoderic acid A decreases the expression of Stearoyl-CoA desaturase (SCD). [58]
25-hydroxycholesterol DMCHAQ7 Investigative 25-hydroxycholesterol decreases the expression of Stearoyl-CoA desaturase (SCD). [59]
Ginsenoside Re DM46FVD Investigative Ginsenoside Re decreases the expression of Stearoyl-CoA desaturase (SCD). [60]
PF-429242 DMB0OZ3 Investigative PF-429242 decreases the expression of Stearoyl-CoA desaturase (SCD). [57]
paxilline DMPF2N1 Investigative paxilline increases the expression of Stearoyl-CoA desaturase (SCD). [61]
CD3254 DM38MU1 Investigative CD3254 increases the expression of Stearoyl-CoA desaturase (SCD). [61]
------------------------------------------------------------------------------------
⏷ Show the Full List of 84 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 increases the phosphorylation of Stearoyl-CoA desaturase (SCD). [44]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
4 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
7 Expression profiling of the estrogen responsive genes in response to phytoestrogens using a customized DNA microarray. FEBS Lett. 2005 Mar 14;579(7):1732-40.
8 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
9 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
10 Inhibition of fatty acid synthase expression by 1alpha,25-dihydroxyvitamin D3 in prostate cancer cells. J Steroid Biochem Mol Biol. 2003 May;85(1):1-8. doi: 10.1016/s0960-0760(03)00142-0.
11 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
12 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
13 Phospholipidosis induced by PPARgama signaling in human bronchial epithelial (BEAS-2B) cells exposed to amiodarone. Toxicol Sci. 2011 Mar;120(1):98-108.
14 The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
15 Activation of the Constitutive Androstane Receptor induces hepatic lipogenesis and regulates Pnpla3 gene expression in a LXR-independent way. Toxicol Appl Pharmacol. 2016 Jul 15;303:90-100. doi: 10.1016/j.taap.2016.05.006. Epub 2016 May 11.
16 Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
17 Apoptosis, cell cycle progression and gene expression in TP53-depleted HCT116 colon cancer cells in response to short-term 5-fluorouracil treatment. Int J Oncol. 2007 Dec;31(6):1491-500.
18 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
19 Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
20 Rosiglitazone increases indexes of stearoyl-CoA desaturase activity in humans: link to insulin sensitization and the role of dominant-negative mutation in peroxisome proliferator-activated receptor-gamma. Diabetes. 2005 May;54(5):1379-84. doi: 10.2337/diabetes.54.5.1379.
21 Oroxylin A prevents alcohol-induced hepatic steatosis through inhibition of hypoxia inducible factor 1alpha. Chem Biol Interact. 2018 Apr 1;285:14-20. doi: 10.1016/j.cbi.2018.02.025. Epub 2018 Feb 21.
22 Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
23 Characterizing the genetic basis for nicotine induced cancer development: a transcriptome sequencing study. PLoS One. 2013 Jun 18;8(6):e67252.
24 Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
25 Nervonoylceramide (C24:1Cer), a lipid biomarker for ocular irritants released from the 3D reconstructed human cornea-like epithelium, MCTT HCE?. Toxicol In Vitro. 2018 Mar;47:94-102. doi: 10.1016/j.tiv.2017.11.008. Epub 2017 Nov 15.
26 Antipsychotic drugs activate SREBP-regulated expression of lipid biosynthetic genes in cultured human glioma cells: a novel mechanism of action? Pharmacogenomics J. 2005;5(5):298-304.
27 Drug-induced hepatic steatosis in absence of severe mitochondrial dysfunction in HepaRG cells: proof of multiple mechanism-based toxicity. Cell Biol Toxicol. 2021 Apr;37(2):151-175. doi: 10.1007/s10565-020-09537-1. Epub 2020 Jun 14.
28 Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
29 Regulation of stearoyl coenzyme A desaturase expression in human retinal pigment epithelial cells by retinoic acid. J Biol Chem. 2001 Aug 3;276(31):28744-50. doi: 10.1074/jbc.M103587200. Epub 2001 Jun 7.
30 Ursodeoxycholic acid but not tauroursodeoxycholic acid inhibits proliferation and differentiation of human subcutaneous adipocytes. PLoS One. 2013 Dec 3;8(12):e82086. doi: 10.1371/journal.pone.0082086. eCollection 2013.
31 Antidepressant drugs activate SREBP and up-regulate cholesterol and fatty acid biosynthesis in human glial cells. Neurosci Lett. 2006 Mar 13;395(3):185-90. doi: 10.1016/j.neulet.2005.10.096. Epub 2005 Dec 1.
32 Rofecoxib modulates multiple gene expression pathways in a clinical model of acute inflammatory pain. Pain. 2007 Mar;128(1-2):136-47.
33 Identification of biomarkers modulated by the rexinoid LGD1069 (bexarotene) in human breast cells using oligonucleotide arrays. Cancer Res. 2006 Dec 15;66(24):12009-18.
34 Identification of novel agonists by high-throughput screening and molecular modelling of human constitutive androstane receptor isoform 3. Arch Toxicol. 2019 Aug;93(8):2247-2264. doi: 10.1007/s00204-019-02495-6. Epub 2019 Jul 16.
35 Effects of four-week high-fructose diet on gene expression in skeletal muscle of healthy men. Diabetes Metab. 2008 Feb;34(1):82-5. doi: 10.1016/j.diabet.2007.08.004. Epub 2007 Dec 11.
36 Molecular mechanisms of hepatotoxic cholestasis by clavulanic acid: Role of NRF2 and FXR pathways. Food Chem Toxicol. 2021 Dec;158:112664. doi: 10.1016/j.fct.2021.112664. Epub 2021 Nov 9.
37 ZD6474 inhibits tumor growth and intraperitoneal dissemination in a highly metastatic orthotopic gastric cancer model. Int J Cancer. 2006 Jan 15;118(2):483-9. doi: 10.1002/ijc.21340.
38 Brexpiprazole suppresses cell proliferation and de novo lipogenesis through AMPK/SREBP1 pathway in colorectal cancer. Environ Toxicol. 2023 Oct;38(10):2352-2360. doi: 10.1002/tox.23871. Epub 2023 Jun 22.
39 Soy isoflavones exert differential effects on androgen responsive genes in LNCaP human prostate cancer cells. J Nutr. 2007 Apr;137(4):964-72.
40 Anti-inflammatory effects of dietary phenolic compounds in an in vitro model of inflamed human intestinal epithelium. Chem Biol Interact. 2010 Dec 5;188(3):659-67.
41 Genistein-induced changes in gene expression in Panc 1 cells at physiological concentrations of genistein. Pancreas. 2004 Aug;29(2):93-8.
42 Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
43 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
44 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
45 Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
46 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
47 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
48 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
49 Ochratoxin a lowers mRNA levels of genes encoding for key proteins of liver cell metabolism. Cancer Genomics Proteomics. 2008 Nov-Dec;5(6):319-32.
50 Primary Human Hepatocyte Spheroids as Tools to Study the Hepatotoxic Potential of Non-Pharmaceutical Chemicals. Int J Mol Sci. 2021 Oct 12;22(20):11005. doi: 10.3390/ijms222011005.
51 Regulation of renal lipid deposition in diabetic nephropathy on morroniside via inhibition of NF-KB/TNF-a/SREBP1c signaling pathway. Chem Biol Interact. 2023 Nov 1;385:110711. doi: 10.1016/j.cbi.2023.110711. Epub 2023 Sep 26.
52 Regulation of stearoyl-coenzyme A desaturase and fatty acid delta-6 desaturase-2 expression by linoleic acid and arachidonic acid in human sebocytes leads to enhancement of proinflammatory activity but does not affect lipogenesis. Br J Dermatol. 2011 Aug;165(2):269-76.
53 Farnesol induces fatty acid oxidation and decreases triglyceride accumulation in steatotic HepaRG cells. Toxicol Appl Pharmacol. 2019 Feb 15;365:61-70.
54 System analysis of cross-talk between nuclear receptors reveals an opposite regulation of the cell cycle by LXR and FXR in human HepaRG liver cells. PLoS One. 2019 Aug 22;14(8):e0220894. doi: 10.1371/journal.pone.0220894. eCollection 2019.
55 Adipocytic differentiation and liver x receptor pathways regulate the accumulation of triacylglycerols in human vascular smooth muscle cells. J Biol Chem. 2005 Feb 4;280(5):3911-9. doi: 10.1074/jbc.M410075200. Epub 2004 Nov 16.
56 AAA-ATPase valosin-containing protein binds the transcription factor SREBP1 and promotes its proteolytic activation by rhomboid protease RHBDL4. J Biol Chem. 2022 Jun;298(6):101936. doi: 10.1016/j.jbc.2022.101936. Epub 2022 Apr 14.
57 Fatostatin inhibits cancer cell proliferation by affecting mitotic microtubule spindle assembly and cell division. J Biol Chem. 2016 Aug 12;291(33):17001-8.
58 Ganoderic Acid A improves high fat diet-induced obesity, lipid accumulation and insulin sensitivity through regulating SREBP pathway. Chem Biol Interact. 2018 Jun 25;290:77-87.
59 Inhibition of SREBP increases gefitinib sensitivity in non-small cell lung cancer cells. Oncotarget. 2016 Aug 9;7(32):52392-52403.
60 Ginsenoside Re lowers blood glucose and lipid levels via activation of AMP-activated protein kinase in HepG2 cells and high-fat diet fed mice. Int J Mol Med. 2012 Jan;29(1):73-80. doi: 10.3892/ijmm.2011.805. Epub 2011 Oct 3.
61 Combinations of LXR and RXR agonists induce triglyceride accumulation in human HepaRG cells in a synergistic manner. Arch Toxicol. 2020 Apr;94(4):1303-1320. doi: 10.1007/s00204-020-02685-7. Epub 2020 Mar 2.
62 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.