Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBR33M9)

• DOT Name: Amino acid transporter heavy chain SLC3A2 (SLC3A2)
• Synonyms: 4F2 cell-surface antigen heavy chain; 4F2hc; 4F2 heavy chain antigen; Lymphocyte activation antigen 4F2 large subunit; Solute carrier family 3 member 2; CD antigen CD98
• Gene Name: SLC3A2
• UniProt ID: 4F2_HUMAN
• PDB ID: 2DH2; 2DH3; 6IRS; 6IRT; 6JMQ; 6JMR; 6S8V; 7B00; 7CCS; 7CMH; 7CMI; 7DF1; 7DSK; 7DSL; 7DSN; 7DSQ; 7EPZ; 7P9U; 7P9V; 8A6L; 8G0M
• Pfam ID: PF00128 ; PF16028
• Sequence:
  MELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSELGSHCVAQTGLELLASGDPLPS
  ASQNAEMIETGSDCVTQAGLQLLASSDPPALASKNAEVTGTMSQDTEVDMKEVELNELEP
  EKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLSKEELLKVAGSPGWVR
  TRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGN
  LAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKK
  SIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFL
  AEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVT
  QYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALP
  GQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGD
  FHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQ
  PGREEGSPLELERLKLEPHEGLLLRFPYAA
• Function: Acts as a chaperone that facilitates biogenesis and trafficking of functional transporters heterodimers to the plasma membrane. Forms heterodimer with SLC7 family transporters (SLC7A5, SLC7A6, SLC7A7, SLC7A8, SLC7A10 and SLC7A11), a group of amino-acid antiporters. Heterodimers function as amino acids exchangers, the specificity of the substrate depending on the SLC7A subunit. Heterodimers SLC3A2/SLC7A6 or SLC3A2/SLC7A7 mediate the uptake of dibasic amino acids. Heterodimer SLC3A2/SLC7A11 functions as an antiporter by mediating the exchange of extracellular anionic L-cystine and intracellular L-glutamate across the cellular plasma membrane. SLC3A2/SLC7A10 translocates small neutral L- and D-amino acids across the plasma membrane. SLC3A2/SLC75 or SLC3A2/SLC7A8 translocates neutral amino acids with broad specificity, thyroid hormones and L-DOPA. SLC3A2 is essential for plasma membrane localization, stability, and the transport activity of SLC7A5 and SLC7A8. When associated with LAPTM4B, the heterodimer SLC7A5 is recruited to lysosomes to promote leucine uptake into these organelles, and thereby mediates mTORC1 activation. Modulates integrin-related signaling and is essential for integrin-dependent cell spreading, migration and tumor progression ; (Microbial infection) In case of hepatitis C virus/HCV infection, the complex formed by SLC3A2 and SLC7A5/LAT1 plays a role in HCV propagation by facilitating viral entry into host cell and increasing L-leucine uptake-mediated mTORC1 signaling activation, thereby contributing to HCV-mediated pathogenesis; (Microbial infection) Acts as a receptor for malaria parasite Plasmodium vivax (Thai isolate) in immature red blood cells.
• Tissue Specificity: Expressed ubiquitously in all tissues tested with highest levels detected in kidney, placenta and testis and weakest level in thymus. During gestation, expression in the placenta was significantly stronger at full-term than at the mid-trimester stage. Expressed in HUVECS and at low levels in resting peripheral blood T-lymphocytes and quiescent fibroblasts. Also expressed in fetal liver and in the astrocytic process of primary astrocytic gliomas. Expressed in retinal endothelial cells and in the intestinal epithelial cell line C2BBe1.
• KEGG Pathway:
  mTOR sig.ling pathway (hsa04150)
  Ferroptosis (hsa04216)
  Protein digestion and absorption (hsa04974)
• Reactome Pathway:
  Amino acid transport across the plasma membrane (R-HSA-352230)
  Defective SLC7A7 causes lysinuric protein intolerance (LPI) (R-HSA-5660862)
  Tryptophan catabolism (R-HSA-71240)
  Basigin interactions (R-HSA-210991)
• BioCyc Pathway: MetaCyc:ENSG00000168003-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Regulation of Drug Effects of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
L-leucine	DMQHN7I	Investigative	Amino acid transporter heavy chain SLC3A2 (SLC3A2) affects the import of L-leucine.	[50]

65 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[5]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[7]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[9]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[10]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[11]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[12]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[13]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[14]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[15]
Selenium	DM25CGV	Approved	Selenium increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[16]
Phenobarbital	DMXZOCG	Approved	Phenobarbital increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[17]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[18]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[19]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[20]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[21]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[5]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[22]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[23]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[24]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[25]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[26]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[5]
Fenofibrate	DMFKXDY	Approved	Fenofibrate increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[5]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide decreases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[11]
Zidovudine	DM4KI7O	Approved	Zidovudine increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[27]
Ifosfamide	DMCT3I8	Approved	Ifosfamide increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[5]
Clodronate	DM9Y6X7	Approved	Clodronate affects the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[5]
Sulindac	DM2QHZU	Approved	Sulindac increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[28]
Ibuprofen	DM8VCBE	Approved	Ibuprofen increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[5]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[29]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[29]
Lindane	DMB8CNL	Approved	Lindane increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[11]
Bicalutamide	DMZMSPF	Approved	Bicalutamide increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[30]
Bosentan	DMIOGBU	Approved	Bosentan increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[31]
Gamolenic acid	DMQN30Z	Approved	Gamolenic acid increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[32]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[33]
Curcumin	DMQPH29	Phase 3	Curcumin increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[34]
Fenretinide	DMRD5SP	Phase 3	Fenretinide increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[35]
HMPL-004	DM29XGY	Phase 3	HMPL-004 decreases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[36]
Bardoxolone methyl	DMODA2X	Phase 3	Bardoxolone methyl decreases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[36]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[21]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[37]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[11]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[38]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[39]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[40]
PMID26394986-Compound-22	DM43Z1G	Patented	PMID26394986-Compound-22 increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[41]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[42]
Celastrol	DMWQIJX	Preclinical	Celastrol increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[43]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[44]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[45]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[36]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[46]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[47]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[48]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[49]
Forskolin	DM6ITNG	Investigative	Forskolin increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[50]
CH-223191	DMMJZYC	Investigative	CH-223191 decreases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[51]
Bilirubin	DMI0V4O	Investigative	Bilirubin increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[52]
Cycloheximide	DMGDA3C	Investigative	Cycloheximide increases the expression of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[53]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic decreases the ubiquitination of Amino acid transporter heavy chain SLC3A2 (SLC3A2).	[8]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
• [3] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [6] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [7] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [8] Quantitative Assessment of Arsenite-Induced Perturbation of Ubiquitinated Proteome. Chem Res Toxicol. 2022 Sep 19;35(9):1589-1597. doi: 10.1021/acs.chemrestox.2c00197. Epub 2022 Aug 22.
• [9] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [10] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [11] Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
• [12] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [13] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [14] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [15] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [16] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [17] Dose- and time-dependent effects of phenobarbital on gene expression profiling in human hepatoma HepaRG cells. Toxicol Appl Pharmacol. 2009 Feb 1;234(3):345-60.
• [18] Identification of novel genes associated with the response to 5-FU treatment in gastric cancer cell lines using a cDNA microarray. Cancer Lett. 2004 Oct 8;214(1):19-33.
• [19] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [20] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [21] Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.
• [22] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [23] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [24] Toxicoproteomics reveals an effect of clozapine on autophagy in human liver spheroids. Toxicol Mech Methods. 2023 Jun;33(5):401-410. doi: 10.1080/15376516.2022.2156005. Epub 2022 Dec 19.
• [25] Anti-inflammatory agent indomethacin reduces invasion and alters metabolism in a human breast cancer cell line. Neoplasia. 2007 Mar;9(3):222-35.
• [26] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [27] Differential gene expression in human hepatocyte cell lines exposed to the antiretroviral agent zidovudine. Arch Toxicol. 2014 Mar;88(3):609-23. doi: 10.1007/s00204-013-1169-3. Epub 2013 Nov 30.
• [28] Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
• [29] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [30] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [31] Omics-based responses induced by bosentan in human hepatoma HepaRG cell cultures. Arch Toxicol. 2018 Jun;92(6):1939-1952.
• [32] Antineoplastic effects of gamma linolenic Acid on hepatocellular carcinoma cell lines. J Clin Biochem Nutr. 2010 Jul;47(1):81-90.
• [33] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [34] Gene-expression profiling during curcumin-induced apoptosis reveals downregulation of CXCR4. Exp Hematol. 2007 Jan;35(1):84-95.
• [35] Regulation of lipocalin-2 gene by the cancer chemopreventive retinoid 4-HPR. Int J Cancer. 2006 Oct 1;119(7):1599-606.
• [36] Mapping the dynamics of Nrf2 antioxidant and NFB inflammatory responses by soft electrophilic chemicals in human liver cells defines the transition from adaptive to adverse responses. Toxicol In Vitro. 2022 Oct;84:105419. doi: 10.1016/j.tiv.2022.105419. Epub 2022 Jun 17.
• [37] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [38] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [39] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [40] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [41] Anticancer effects of non-steroidal anti-inflammatory drugs against cancer cells and cancer stem cells. Toxicol In Vitro. 2021 Aug;74:105155. doi: 10.1016/j.tiv.2021.105155. Epub 2021 Mar 27.
• [42] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [43] Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.
• [44] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [45] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [46] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [47] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [48] CD34+ derived macrophage and dendritic cells display differential responses to paraquat. Toxicol In Vitro. 2021 Sep;75:105198. doi: 10.1016/j.tiv.2021.105198. Epub 2021 Jun 9.
• [49] Early gene response in lithium chloride induced apoptosis. Apoptosis. 2005 Jan;10(1):75-90. doi: 10.1007/s10495-005-6063-x.
• [50] Methylmercury Uptake into BeWo Cells Depends on LAT2-4F2hc, a System L Amino Acid Transporter. Int J Mol Sci. 2017 Aug 8;18(8):1730. doi: 10.3390/ijms18081730.
• [51] The Ah receptor regulates growth factor expression in head and neck squamous cell carcinoma cell lines. Mol Carcinog. 2014 Oct;53(10):765-76.
• [52] Functional induction of the cystine-glutamate exchanger system Xc(-) activity in SH-SY5Y cells by unconjugated bilirubin. PLoS One. 2011;6(12):e29078. doi: 10.1371/journal.pone.0029078. Epub 2011 Dec 27.
• [53] Aryl hydrocarbon receptor-dependent up-regulation of the heterodimeric amino acid transporter LAT1 (SLC7A5)/CD98hc (SLC3A2) by diesel exhaust particle extract in human bronchial epithelial cells. Toxicol Appl Pharmacol. 2016 Jan 1;290:74-85.