Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC39NSU)

DOT Name CCN family member 2 (CCN2)
Synonyms
Cellular communication network factor 2; Connective tissue growth factor; Hypertrophic chondrocyte-specific protein 24; Insulin-like growth factor-binding protein 8; IBP-8; IGF-binding protein 8; IGFBP-8
Gene Name CCN2
UniProt ID
CCN2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00007 ; PF00219 ; PF19035 ; PF00093
Sequence
MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVC
AKQLGELCTERDPCDPHKGLFCHFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSC
KYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA
AYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR
PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTT
LPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
Function
Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.
Tissue Specificity Expressed in bone marrow and thymic cells. Also expressed one of two Wilms tumors tested.
KEGG Pathway
Apelin sig.ling pathway (hsa04371 )
Hippo sig.ling pathway (hsa04390 )
Reactome Pathway
RUNX3 regulates YAP1-mediated transcription (R-HSA-8951671 )
YAP1- and WWTR1 (TAZ)-stimulated gene expression (R-HSA-2032785 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Methotrexate DM2TEOL Approved CCN family member 2 (CCN2) decreases the response to substance of Methotrexate. [60]
Vinblastine DM5TVS3 Approved CCN family member 2 (CCN2) affects the response to substance of Vinblastine. [61]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of CCN family member 2 (CCN2). [1]
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of CCN family member 2 (CCN2). [44]
------------------------------------------------------------------------------------
62 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of CCN family member 2 (CCN2). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of CCN family member 2 (CCN2). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of CCN family member 2 (CCN2). [4]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of CCN family member 2 (CCN2). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate affects the expression of CCN family member 2 (CCN2). [6]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of CCN family member 2 (CCN2). [7]
Estradiol DMUNTE3 Approved Estradiol increases the expression of CCN family member 2 (CCN2). [8]
Arsenic DMTL2Y1 Approved Arsenic affects the expression of CCN family member 2 (CCN2). [9]
Quercetin DM3NC4M Approved Quercetin decreases the expression of CCN family member 2 (CCN2). [10]
Temozolomide DMKECZD Approved Temozolomide increases the expression of CCN family member 2 (CCN2). [11]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the expression of CCN family member 2 (CCN2). [12]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of CCN family member 2 (CCN2). [13]
Triclosan DMZUR4N Approved Triclosan affects the expression of CCN family member 2 (CCN2). [14]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of CCN family member 2 (CCN2). [15]
Decitabine DMQL8XJ Approved Decitabine increases the expression of CCN family member 2 (CCN2). [16]
Marinol DM70IK5 Approved Marinol increases the expression of CCN family member 2 (CCN2). [17]
Phenobarbital DMXZOCG Approved Phenobarbital decreases the expression of CCN family member 2 (CCN2). [18]
Menadione DMSJDTY Approved Menadione affects the expression of CCN family member 2 (CCN2). [19]
Fluorouracil DMUM7HZ Approved Fluorouracil affects the expression of CCN family member 2 (CCN2). [20]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the expression of CCN family member 2 (CCN2). [21]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of CCN family member 2 (CCN2). [22]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of CCN family member 2 (CCN2). [23]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of CCN family member 2 (CCN2). [24]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the expression of CCN family member 2 (CCN2). [23]
Ethanol DMDRQZU Approved Ethanol decreases the expression of CCN family member 2 (CCN2). [25]
Etoposide DMNH3PG Approved Etoposide increases the expression of CCN family member 2 (CCN2). [26]
Irinotecan DMP6SC2 Approved Irinotecan increases the expression of CCN family member 2 (CCN2). [27]
Piroxicam DMTK234 Approved Piroxicam decreases the expression of CCN family member 2 (CCN2). [28]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate decreases the expression of CCN family member 2 (CCN2). [29]
Ethinyl estradiol DMODJ40 Approved Ethinyl estradiol decreases the expression of CCN family member 2 (CCN2). [30]
Cocaine DMSOX7I Approved Cocaine decreases the expression of CCN family member 2 (CCN2). [31]
Prednisolone DMQ8FR2 Approved Prednisolone increases the expression of CCN family member 2 (CCN2). [32]
Methylprednisolone DM4BDON Approved Methylprednisolone increases the expression of CCN family member 2 (CCN2). [32]
Aldosterone DM9S2JW Approved Aldosterone increases the expression of CCN family member 2 (CCN2). [33]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of CCN family member 2 (CCN2). [34]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of CCN family member 2 (CCN2). [35]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of CCN family member 2 (CCN2). [36]
Chlorpromazine DMBGZI3 Phase 3 Trial Chlorpromazine decreases the expression of CCN family member 2 (CCN2). [37]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of CCN family member 2 (CCN2). [38]
Belinostat DM6OC53 Phase 2 Belinostat increases the expression of CCN family member 2 (CCN2). [39]
Afimoxifene DMFORDT Phase 2 Afimoxifene increases the expression of CCN family member 2 (CCN2). [8]
ACYLINE DM9GRTK Phase 2 ACYLINE decreases the expression of CCN family member 2 (CCN2). [40]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of CCN family member 2 (CCN2). [41]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of CCN family member 2 (CCN2). [42]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of CCN family member 2 (CCN2). [43]
Sphingosine-1-Phosphate DMJCQKA Phase 1 Sphingosine-1-Phosphate increases the expression of CCN family member 2 (CCN2). [45]
T83193 DMHO29Y Patented T83193 decreases the expression of CCN family member 2 (CCN2). [46]
SB 203580 DMAET6F Terminated SB 203580 decreases the expression of CCN family member 2 (CCN2). [47]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of CCN family member 2 (CCN2). [48]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of CCN family member 2 (CCN2). [39]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of CCN family member 2 (CCN2). [49]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of CCN family member 2 (CCN2). [50]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate decreases the expression of CCN family member 2 (CCN2). [51]
Paraquat DMR8O3X Investigative Paraquat increases the expression of CCN family member 2 (CCN2). [52]
D-glucose DMMG2TO Investigative D-glucose increases the expression of CCN family member 2 (CCN2). [53]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of CCN family member 2 (CCN2). [54]
cinnamaldehyde DMZDUXG Investigative cinnamaldehyde decreases the expression of CCN family member 2 (CCN2). [46]
CH-223191 DMMJZYC Investigative CH-223191 increases the expression of CCN family member 2 (CCN2). [55]
Cycloheximide DMGDA3C Investigative Cycloheximide increases the expression of CCN family member 2 (CCN2). [56]
3,7,3',4'-TETRAHYDROXYFLAVONE DMES906 Investigative 3,7,3',4'-TETRAHYDROXYFLAVONE decreases the expression of CCN family member 2 (CCN2). [57]
LICOAGROCHACONE A DMWY0TN Investigative LICOAGROCHACONE A decreases the expression of CCN family member 2 (CCN2). [58]
Ginsenoside RG3 DMFN58T Investigative Ginsenoside RG3 decreases the expression of CCN family member 2 (CCN2). [59]
------------------------------------------------------------------------------------
⏷ Show the Full List of 62 Drug(s)

References

1 Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
4 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
5 Alteration of genomic responses to doxorubicin and prevention of MDR in breast cancer cells by a polymer excipient: pluronic P85. Mol Pharm. 2006 Mar-Apr;3(2):113-23.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
8 Estrogenic GPR30 signalling induces proliferation and migration of breast cancer cells through CTGF. EMBO J. 2009 Mar 4;28(5):523-32.
9 Prenatal arsenic exposure and shifts in the newborn proteome: interindividual differences in tumor necrosis factor (TNF)-responsive signaling. Toxicol Sci. 2014 Jun;139(2):328-37. doi: 10.1093/toxsci/kfu053. Epub 2014 Mar 27.
10 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
11 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
12 Unique signatures of stress-induced senescent human astrocytes. Exp Neurol. 2020 Dec;334:113466. doi: 10.1016/j.expneurol.2020.113466. Epub 2020 Sep 17.
13 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
14 The modulatory effect of triclosan on the reversion of the activated phenotype of LX-2 hepatic stellate cells. J Biochem Mol Toxicol. 2020 Jan;34(1):e22413. doi: 10.1002/jbt.22413. Epub 2019 Nov 12.
15 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
16 Characterization of DOK1, a candidate tumor suppressor gene, in epithelial ovarian cancer. Mol Oncol. 2011 Oct;5(5):438-53. doi: 10.1016/j.molonc.2011.07.003. Epub 2011 Jul 26.
17 Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
18 Dose- and time-dependent effects of phenobarbital on gene expression profiling in human hepatoma HepaRG cells. Toxicol Appl Pharmacol. 2009 Feb 1;234(3):345-60.
19 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
20 Cell-type-specific responses to chemotherapeutics in breast cancer. Cancer Res. 2004 Jun 15;64(12):4218-26.
21 Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
22 Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
23 Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
24 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
25 Cardiac toxicity from ethanol exposure in human-induced pluripotent stem cell-derived cardiomyocytes. Toxicol Sci. 2019 May 1;169(1):280-292.
26 Cell death mechanisms of the anti-cancer drug etoposide on human cardiomyocytes isolated from pluripotent stem cells. Arch Toxicol. 2018 Apr;92(4):1507-1524.
27 Gene expression profile of colon cancer cell lines treated with SN-38. Chemotherapy. 2010;56(1):17-25. doi: 10.1159/000287353. Epub 2010 Feb 24.
28 Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
29 Identification of cornifelin and early growth response-1 gene as novel biomarkers for in vitro eye irritation using a 3D reconstructed human cornea model MCTT HCE?. Arch Toxicol. 2015 Sep;89(9):1589-98. doi: 10.1007/s00204-014-1390-8. Epub 2014 Nov 7.
30 The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
31 Gene expression in human hippocampus from cocaine abusers identifies genes which regulate extracellular matrix remodeling. PLoS One. 2007 Nov 14;2(11):e1187. doi: 10.1371/journal.pone.0001187.
32 Antirheumatic drug response signatures in human chondrocytes: potential molecular targets to stimulate cartilage regeneration. Arthritis Res Ther. 2009;11(1):R15.
33 Modelling cardiac fibrosis using three-dimensional cardiac microtissues derived from human embryonic stem cells. J Biol Eng. 2019 Feb 13;13:15. doi: 10.1186/s13036-019-0139-6. eCollection 2019.
34 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
35 Grape resveratrol increases serum adiponectin and downregulates inflammatory genes in peripheral blood mononuclear cells: a triple-blind, placebo-controlled, one-year clinical trial in patients with stable coronary artery disease. Cardiovasc Drugs Ther. 2013 Feb;27(1):37-48. doi: 10.1007/s10557-012-6427-8.
36 Curcumin inhibits connective tissue growth factor gene expression in activated hepatic stellate cells in vitro by blocking NF-kappaB and ERK signalling. Br J Pharmacol. 2008 Feb;153(3):557-67. doi: 10.1038/sj.bjp.0707542. Epub 2007 Oct 29.
37 The antipsychotic chlorpromazine suppresses YAP signaling, stemness properties, and drug resistance in breast cancer cells. Chem Biol Interact. 2019 Apr 1;302:28-35. doi: 10.1016/j.cbi.2019.01.033. Epub 2019 Jan 28.
38 Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
39 Gene expression-signature of belinostat in cell lines is specific for histone deacetylase inhibitor treatment, with a corresponding signature in xenografts. Anticancer Drugs. 2009 Sep;20(8):682-92.
40 Intraprostatic androgens and androgen-regulated gene expression persist after testosterone suppression: therapeutic implications for castration-resistant prostate cancer. Cancer Res. 2007 May 15;67(10):5033-41.
41 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
42 The BET bromodomain inhibitor JQ1 suppresses growth of pancreatic ductal adenocarcinoma in patient-derived xenograft models. Oncogene. 2016 Feb 18;35(7):833-45.
43 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
44 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
45 Actin polymerization-enhancing drugs promote ovarian follicle growth mediated by the Hippo signaling effector YAP. FASEB J. 2015 Jun;29(6):2423-30. doi: 10.1096/fj.14-267856. Epub 2015 Feb 17.
46 Antimutagenicity of cinnamaldehyde and vanillin in human cells: Global gene expression and possible role of DNA damage and repair. Mutat Res. 2007 Mar 1;616(1-2):60-9. doi: 10.1016/j.mrfmmm.2006.11.022. Epub 2006 Dec 18.
47 A novel cell permeant peptide inhibitor of MAPKAP kinase II inhibits intimal hyperplasia in a human saphenous vein organ culture model. J Vasc Surg. 2010 Dec;52(6):1596-607. doi: 10.1016/j.jvs.2010.06.168. Epub 2010 Sep 22.
48 Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
49 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
50 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
51 Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
52 Vascular endothelial growth factor reduced and connective tissue growth factor induced by triamcinolone in ARPE19 cells under oxidative stress. Invest Ophthalmol Vis Sci. 2005 Mar;46(3):1062-8. doi: 10.1167/iovs.04-0761.
53 Suppression subtractive hybridization identifies high glucose levels as a stimulus for expression of connective tissue growth factor and other genes in human mesangial cells. J Biol Chem. 1999 Feb 26;274(9):5830-4. doi: 10.1074/jbc.274.9.5830.
54 Altered gene expression patterns in MCF-7 cells induced by the urban dust particulate complex mixture standard reference material 1649a. Cancer Res. 2005 Feb 15;65(4):1251-8.
55 Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.
56 Comparative analysis of AhR-mediated TCDD-elicited gene expression in human liver adult stem cells. Toxicol Sci. 2009 Nov;112(1):229-44.
57 Fisetin activates Hippo pathway and JNK/ERK/AP-1 signaling to inhibit proliferation and induce apoptosis of human osteosarcoma cells via ZAK overexpression. Environ Toxicol. 2019 Aug;34(8):902-911. doi: 10.1002/tox.22761. Epub 2019 May 1.
58 Licochalcone A inhibits cell growth through the downregulation of the Hippo pathway via PES1 in cholangiocarcinoma cells. Environ Toxicol. 2022 Mar;37(3):564-573. doi: 10.1002/tox.23422. Epub 2021 Nov 30.
59 Ginsenoside Rg3 attenuates the osimertinib resistance by reducing the stemness of non-small cell lung cancer cells. Environ Toxicol. 2020 Jun;35(6):643-651. doi: 10.1002/tox.22899. Epub 2020 Jan 9.
60 Targeting connective tissue growth factor (CTGF) in acute lymphoblastic leukemia preclinical models: anti-CTGF monoclonal antibody attenuates leukemia growth. Ann Hematol. 2014 Mar;93(3):485-492. doi: 10.1007/s00277-013-1939-2. Epub 2013 Oct 24.
61 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.