Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC3IJV4)

DOT Name ATP-binding cassette sub-family C member 3 (ABCC3)
Synonyms EC 7.6.2.-; EC 7.6.2.2; EC 7.6.2.3; Canalicular multispecific organic anion transporter 2; Multi-specific organic anion transporter D; MOAT-D; Multidrug resistance-associated protein 3
Gene Name ABCC3
UniProt ID
MRP3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
8HVH; 8HW2; 8HW4
EC Number
7.6.2.-; 7.6.2.2; 7.6.2.3
Pfam ID
PF00664 ; PF00005
Sequence
MDALCGSGELGSKFWDSNLSVHTENPDLTPCFQNSLLAWVPCIYLWVALPCYLLYLRHHC
RGYIILSHLSKLKMVLGVLLWCVSWADLFYSFHGLVHGRAPAPVFFVTPLVVGVTMLLAT
LLIQYERLQGVQSSGVLIIFWFLCVVCAIVPFRSKILLAKAEGEISDPFRFTTFYIHFAL
VLSALILACFREKPPFFSAKNVDPNPYPETSAGFLSRLFFWWFTKMAIYGYRHPLEEKDL
WSLKEEDRSQMVVQQLLEAWRKQEKQTARHKASAAPGKNASGEDEVLLGARPRPRKPSFL
KALLATFGSSFLISACFKLIQDLLSFINPQLLSILIRFISNPMAPSWWGFLVAGLMFLCS
MMQSLILQHYYHYIFVTGVKFRTGIMGVIYRKALVITNSVKRASTVGEIVNLMSVDAQRF
MDLAPFLNLLWSAPLQIILAIYFLWQNLGPSVLAGVAFMVLLIPLNGAVAVKMRAFQVKQ
MKLKDSRIKLMSEILNGIKVLKLYAWEPSFLKQVEGIRQGELQLLRTAAYLHTTTTFTWM
CSPFLVTLITLWVYVYVDPNNVLDAEKAFVSVSLFNILRLPLNMLPQLISNLTQASVSLK
RIQQFLSQEELDPQSVERKTISPGYAITIHSGTFTWAQDLPPTLHSLDIQVPKGALVAVV
GPVGCGKSSLVSALLGEMEKLEGKVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRY
QQTLEACALLADLEMLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDADIFLLDDPLSA
VDSHVAKHIFDHVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLADGQVSEMGPYPALLQ
RNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQ
KQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAAIGTVELSVFW
DYAKAVGLCTTLAICLLYVGQSAAAIGANVWLSAWTNDAMADSRQNNTSLRLGVYAALGI
LQGFLVMLAAMAMAAGGIQAARVLHQALLHNKIRSPQSFFDTTPSGRILNCFSKDIYVVD
EVLAPVILMLLNSFFNAISTLVVIMASTPLFTVVILPLAVLYTLVQRFYAATSRQLKRLE
SVSRSPIYSHFSETVTGASVIRAYNRSRDFEIISDTKVDANQRSCYPYIISNRWLSIGVE
FVGNCVVLFAALFAVIGRSSLNPGLVGLSVSYSLQVTFALNWMIRMMSDLESNIVAVERV
KEYSKTETEAPWVVEGSRPPEGWPPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVG
IVGRTGAGKSSMTLCLFRILEAAKGEIRIDGLNVADIGLHDLRSQLTIIPQDPILFSGTL
RMNLDPFGSYSEEDIWWALELSHLHTFVSSQPAGLDFQCSEGGENLSVGQRQLVCLARAL
LRKSRILVLDEATAAIDLETDNLIQATIRTQFDTCTVLTIAHRLNTIMDYTRVLVLDKGV
VAEFDSPANLIAARGIFYGMARDAGLA
Function
ATP-dependent transporter of the ATP-binding cassette (ABC) family that binds and hydrolyzes ATP to enable active transport of various substrates including many drugs, toxicants and endogenous compound across cell membranes. Transports glucuronide conjugates such as bilirubin diglucuronide, estradiol-17-beta-o-glucuronide and GSH conjugates such as leukotriene C4 (LTC4). Transports also various bile salts (taurocholate, glycocholate, taurochenodeoxycholate-3-sulfate, taurolithocholate- 3-sulfate). Does not contribute substantially to bile salt physiology but provides an alternative route for the export of bile acids and glucuronides from cholestatic hepatocytes. May contribute to regulate the transport of organic compounds in testes across the blood-testis-barrier (Probable). Can confer resistance to various anticancer drugs, methotrexate, tenoposide and etoposide, by decreasing accumulation of these drugs in cells.
Tissue Specificity
Mainly expressed in the liver. Also expressed in small intestine, colon, prostate, testis, brain and at a lower level in the kidney. In testis, localized to peritubular myoid cells, Leydig cells, along the basal membrane of Sertoli cells and moderately in the adluminal compartment of the seminiferous tubules .
KEGG Pathway
Antifolate resistance (hsa01523 )
ABC transporters (hsa02010 )
Bile secretion (hsa04976 )
Reactome Pathway
ABC-family proteins mediated transport (R-HSA-382556 )
Aspirin ADME (R-HSA-9749641 )
Paracetamol ADME (R-HSA-9753281 )
NFE2L2 regulating MDR associated enzymes (R-HSA-9818032 )
Recycling of bile acids and salts (R-HSA-159418 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 5 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved ATP-binding cassette sub-family C member 3 (ABCC3) decreases the response to substance of Doxorubicin. [52]
Ivermectin DMDBX5F Approved ATP-binding cassette sub-family C member 3 (ABCC3) increases the Cell-mediated cytotoxicity ADR of Ivermectin. [53]
Methotrexate DM2TEOL Approved ATP-binding cassette sub-family C member 3 (ABCC3) affects the response to substance of Methotrexate. [54]
Etoposide DMNH3PG Approved ATP-binding cassette sub-family C member 3 (ABCC3) decreases the response to substance of Etoposide. [55]
Sorafenib DMS8IFC Approved ATP-binding cassette sub-family C member 3 (ABCC3) affects the response to substance of Sorafenib. [57]
------------------------------------------------------------------------------------
This DOT Affected the Regulation of Drug Effects of 5 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Ethinyl estradiol DMODJ40 Approved ATP-binding cassette sub-family C member 3 (ABCC3) increases the uptake of Ethinyl estradiol. [56]
Taurocholic acid DM2LZ8F Phase 1/2 ATP-binding cassette sub-family C member 3 (ABCC3) increases the uptake of Taurocholic acid. [58]
15-deoxy-Delta(12, 14)-prostaglandin J(2) DM8VUX3 Investigative ATP-binding cassette sub-family C member 3 (ABCC3) affects the export of 15-deoxy-Delta(12, 14)-prostaglandin J(2). [59]
G418 DMKTJBU Investigative ATP-binding cassette sub-family C member 3 (ABCC3) increases the transport of G418. [60]
[3H]estradiol-17beta-glucuronide DM3KJ45 Investigative ATP-binding cassette sub-family C member 3 (ABCC3) increases the transport of [3H]estradiol-17beta-glucuronide. [61]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of ATP-binding cassette sub-family C member 3 (ABCC3). [1]
Simvastatin DM30SGU Approved Simvastatin increases the nitrosation of ATP-binding cassette sub-family C member 3 (ABCC3). [25]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of ATP-binding cassette sub-family C member 3 (ABCC3). [45]
------------------------------------------------------------------------------------
70 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [5]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [6]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [7]
Temozolomide DMKECZD Approved Temozolomide increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [8]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [9]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [10]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [11]
Triclosan DMZUR4N Approved Triclosan decreases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [12]
Decitabine DMQL8XJ Approved Decitabine increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [13]
Phenobarbital DMXZOCG Approved Phenobarbital increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [14]
Progesterone DMUY35B Approved Progesterone increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [15]
Menadione DMSJDTY Approved Menadione affects the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [10]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [7]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [16]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [17]
Troglitazone DM3VFPD Approved Troglitazone increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [18]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [19]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol decreases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [20]
Ethanol DMDRQZU Approved Ethanol increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [21]
Paclitaxel DMLB81S Approved Paclitaxel increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [6]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [22]
Dasatinib DMJV2EK Approved Dasatinib increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [23]
Indomethacin DMSC4A7 Approved Indomethacin increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [24]
Rifampicin DM5DSFZ Approved Rifampicin increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [26]
Mifepristone DMGZQEF Approved Mifepristone increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [26]
Zidovudine DM4KI7O Approved Zidovudine increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [27]
Clodronate DM9Y6X7 Approved Clodronate increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [28]
Sulindac DM2QHZU Approved Sulindac increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [24]
Ursodeoxycholic acid DMCUT21 Approved Ursodeoxycholic acid increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [29]
Hydrocortisone DMGEMB7 Approved Hydrocortisone increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [16]
Nefazodone DM4ZS8M Approved Nefazodone decreases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [30]
Chenodiol DMQ8JIK Approved Chenodiol increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [31]
Ampicillin DMHWE7P Approved Ampicillin decreases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [32]
Bosentan DMIOGBU Approved Bosentan decreases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [33]
Isoproterenol DMK7MEY Approved Isoproterenol decreases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [34]
Deoxycholic acid DM3GYAL Approved Deoxycholic acid increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [29]
Atazanavir DMSYRBX Approved Atazanavir decreases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [30]
Clotrimazole DMMFCIH Approved Clotrimazole increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [35]
Nifedipine DMSVOZT Approved Nifedipine increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [26]
Methoxsalen DME8FZ9 Approved Methoxsalen increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [36]
Prednisone DM2HG4X Approved Prednisone increases the activity of ATP-binding cassette sub-family C member 3 (ABCC3). [16]
Cholic acid DM7OKQV Approved Cholic acid increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [29]
Calcipotriol DM03CP7 Approved Calcipotriol increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [36]
Metyrapone DMI7FVQ Approved Metyrapone increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [26]
Meclizine DMS7T13 Approved Meclizine increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [21]
Tolvaptan DMIWFRL Approved Tolvaptan decreases the activity of ATP-binding cassette sub-family C member 3 (ABCC3). [37]
Macitentan DMP79A1 Approved Macitentan decreases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [33]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [38]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [39]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [40]
Chlorpromazine DMBGZI3 Phase 3 Trial Chlorpromazine increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [41]
TAK-875 DMIM5AP Phase 3 TAK-875 decreases the activity of ATP-binding cassette sub-family C member 3 (ABCC3). [42]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [20]
GSK2110183 DMZHB37 Phase 2 GSK2110183 increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [43]
Afimoxifene DMFORDT Phase 2 Afimoxifene increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [7]
SEN-196 DMLDBQ5 Phase 2 SEN-196 decreases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [44]
PMID26560530-Compound-34 DMLGZPO Patented PMID26560530-Compound-34 increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [46]
CAMBINOL DMW46GY Patented CAMBINOL increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [44]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [40]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [47]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [48]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [49]
cinnamaldehyde DMZDUXG Investigative cinnamaldehyde increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [50]
Okadaic acid DM47CO1 Investigative Okadaic acid decreases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [51]
Cycloheximide DMGDA3C Investigative Cycloheximide increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [7]
DM9CEI5 increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [26]
pregnenolone-16alpha-carbonitrile DM0LW7G Investigative pregnenolone-16alpha-carbonitrile increases the expression of ATP-binding cassette sub-family C member 3 (ABCC3). [26]
------------------------------------------------------------------------------------
⏷ Show the Full List of 70 Drug(s)

References

1 Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
4 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
5 Expression of copper-responsive genes in HepG2 cells. Mol Cell Biochem. 2005 Nov;279(1-2):141-7.
6 Evaluation of drug transporters' significance for multidrug resistance in head and neck squamous cell carcinoma. Head Neck. 2011 Jul;33(7):959-68. doi: 10.1002/hed.21559. Epub 2010 Aug 24.
7 Estrogen regulation in human breast cancer cells of new downstream gene targets involved in estrogen metabolism, cell proliferation and cell transformation. J Mol Endocrinol. 2004 Apr;32(2):397-414.
8 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
9 In vitro study of transporters involved in intestinal absorption of inorganic arsenic. Chem Res Toxicol. 2012 Feb 20;25(2):446-53. doi: 10.1021/tx200491f. Epub 2012 Jan 26.
10 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
11 Vitamin D receptor-dependent regulation of colon multidrug resistance-associated protein 3 gene expression by bile acids. J Biol Chem. 2005 Jun 17;280(24):23232-42. doi: 10.1074/jbc.M411520200. Epub 2005 Apr 11.
12 Primary Human Hepatocyte Spheroids as Tools to Study the Hepatotoxic Potential of Non-Pharmaceutical Chemicals. Int J Mol Sci. 2021 Oct 12;22(20):11005. doi: 10.3390/ijms222011005.
13 Methylation-dependent silencing of the reduced folate carrier gene in inherently methotrexate-resistant human breast cancer cells. J Biol Chem. 2001 Oct 26;276(43):39990-40000.
14 Proteomic analysis of hepatic effects of phenobarbital in mice with humanized liver. Arch Toxicol. 2022 Oct;96(10):2739-2754. doi: 10.1007/s00204-022-03338-7. Epub 2022 Jul 26.
15 Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
16 Differential regulation of the human MRP2 and MRP3 gene expression by glucocorticoids. J Steroid Biochem Mol Biol. 2005 Aug;96(3-4):229-34. doi: 10.1016/j.jsbmb.2005.03.004.
17 Cannabidiol induces antioxidant pathways in keratinocytes by targeting BACH1. Redox Biol. 2020 Jan;28:101321. doi: 10.1016/j.redox.2019.101321. Epub 2019 Sep 5.
18 Species-specific toxicity of diclofenac and troglitazone in primary human and rat hepatocytes. Chem Biol Interact. 2009 Apr 15;179(1):17-24.
19 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
20 Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.
21 Prenatal ethanol exposure increases maternal bile acids through placental transport pathway. Toxicology. 2021 Jun 30;458:152848. doi: 10.1016/j.tox.2021.152848. Epub 2021 Jul 2.
22 CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
23 Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
24 Induction of multidrug resistance proteins MRP1 and MRP3 and gamma-glutamylcysteine synthetase gene expression by nonsteroidal anti-inflammatory drugs in human colon cancer cells. Biochem Biophys Res Commun. 2002 Feb 8;290(5):1427-33. doi: 10.1006/bbrc.2002.6367.
25 Activation of nuclear factor-kappa B pathway by simvastatin and RhoA silencing increases doxorubicin cytotoxicity in human colon cancer HT29 cells. Mol Pharmacol. 2008 Aug;74(2):476-84.
26 Induction of ABCC3 (MRP3) by pregnane X receptor activators. Drug Metab Dispos. 2003 Nov;31(11):1296-9. doi: 10.1124/dmd.31.11.1296.
27 Differential gene expression in human hepatocyte cell lines exposed to the antiretroviral agent zidovudine. Arch Toxicol. 2014 Mar;88(3):609-23. doi: 10.1007/s00204-013-1169-3. Epub 2013 Nov 30.
28 Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
29 Potency of individual bile acids to regulate bile acid synthesis and transport genes in primary human hepatocyte cultures. Toxicol Sci. 2014 Oct;141(2):538-46. doi: 10.1093/toxsci/kfu151. Epub 2014 Jul 23.
30 Robustness testing and optimization of an adverse outcome pathway on cholestatic liver injury. Arch Toxicol. 2020 Apr;94(4):1151-1172. doi: 10.1007/s00204-020-02691-9. Epub 2020 Mar 10.
31 The role of lithocholic acid in the regulation of bile acid detoxication, synthesis, and transport proteins in rat and human intestine and liver slices. Toxicol In Vitro. 2011 Feb;25(1):80-90.
32 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
33 From the Cover: MechanisticInsights in Cytotoxic and Cholestatic Potential of the Endothelial Receptor Antagonists Using HepaRG Cells. Toxicol Sci. 2017 Jun 1;157(2):451-464. doi: 10.1093/toxsci/kfx062.
34 Isoproterenol effects evaluated in heart slices of human and rat in comparison to rat heart in vivo. Toxicol Appl Pharmacol. 2014 Jan 15;274(2):302-12.
35 Activation of p38 Mitogen-Activated Protein Kinase by Clotrimazole Induces Multidrug Resistance-Associated Protein 3 Activation through a Novel Transcriptional Element. J Pharmacol Exp Ther. 2016 Oct;359(1):102-9. doi: 10.1124/jpet.115.231589. Epub 2016 Aug 9.
36 Adaptive homeostasis of the vitamin D-vitamin D nuclear receptor axis in 8-methoxypsoralen-induced hepatotoxicity. Toxicol Appl Pharmacol. 2019 Jan 1;362:150-158. doi: 10.1016/j.taap.2018.11.002. Epub 2018 Nov 10.
37 Inhibition of Human Hepatic Bile Acid Transporters by Tolvaptan and Metabolites: Contributing Factors to Drug-Induced Liver Injury?. Toxicol Sci. 2016 Jan;149(1):237-50. doi: 10.1093/toxsci/kfv231. Epub 2015 Oct 26.
38 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
39 Androgen induces expression of the multidrug resistance protein gene MRP4 in prostate cancer cells. Prostate Cancer Prostatic Dis. 2007;10(1):39-45.
40 Effects of endocrine disruptors on genes associated with 17beta-estradiol metabolism and excretion. Steroids. 2008 Nov;73(12):1242-51.
41 Effects of chlorpromazine with and without UV irradiation on gene expression of HepG2 cells. Mutat Res. 2005 Aug 4;575(1-2):47-60. doi: 10.1016/j.mrfmmm.2005.03.002. Epub 2005 Apr 26.
42 Fasiglifam (TAK-875): Mechanistic Investigation and Retrospective Identification of Hazards for Drug Induced Liver Injury. Toxicol Sci. 2018 Jun 1;163(2):374-384. doi: 10.1093/toxsci/kfx040.
43 Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
44 Inhibition of sirtuins 1 and 2 impairs cell survival and migration and modulates the expression of P-glycoprotein and MRP3 in hepatocellular carcinoma cell lines. Toxicol Lett. 2018 Jun 1;289:63-74. doi: 10.1016/j.toxlet.2018.03.011. Epub 2018 Mar 12.
45 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
46 Differential regulation of sinusoidal and canalicular hepatic drug transporter expression by xenobiotics activating drug-sensing receptors in primary human hepatocytes. Drug Metab Dispos. 2006 Oct;34(10):1756-63. doi: 10.1124/dmd.106.010033. Epub 2006 Jul 12.
47 Characterization of the 5'-flanking region of the human multidrug resistance protein 2 (MRP2) gene and its regulation in comparison withthe multidrug resistance protein 3 (MRP3) gene. Eur J Biochem. 2000 Mar;267(5):1347-58. doi: 10.1046/j.1432-1327.2000.01106.x.
48 Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
49 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
50 Comparative DNA microarray analysis of human monocyte derived dendritic cells and MUTZ-3 cells exposed to the moderate skin sensitizer cinnamaldehyde. Toxicol Appl Pharmacol. 2009 Sep 15;239(3):273-83.
51 Comparison of long-term versus short-term effects of okadaic acid on the apoptotic status of human HepaRG cells. Chem Biol Interact. 2020 Feb 1;317:108937. doi: 10.1016/j.cbi.2020.108937. Epub 2020 Jan 8.
52 Nitric oxide reverts the resistance to doxorubicin in human colon cancer cells by inhibiting the drug efflux. Cancer Res. 2005 Jan 15;65(2):516-25.
53 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
54 Gene expression profiling of leukemia T-cells resistant to methotrexate and 7-hydroxymethotrexate reveals alterations that preserve intracellular levels of folate and nucleotide biosynthesis. Biochem Pharmacol. 2009 Apr 15;77(8):1410-7.
55 Drug sensitivity and drug resistance profiles of human intrahepatic cholangiocarcinoma cell lines. World J Gastroenterol. 2005 May 14;11(18):2748-53. doi: 10.3748/wjg.v11.i18.2748.
56 Transport of ethinylestradiol glucuronide and ethinylestradiol sulfate by the multidrug resistance proteins MRP1, MRP2, and MRP3. J Pharmacol Exp Ther. 2004 Apr;309(1):156-64. doi: 10.1124/jpet.103.062091. Epub 2004 Jan 13.
57 The Enhanced metastatic potential of hepatocellular carcinoma (HCC) cells with sorafenib resistance. PLoS One. 2013 Nov 11;8(11):e78675. doi: 10.1371/journal.pone.0078675. eCollection 2013.
58 Uremic solutes modulate hepatic bile acid handling and induce mitochondrial toxicity. Toxicol In Vitro. 2019 Apr;56:52-61. doi: 10.1016/j.tiv.2019.01.003. Epub 2019 Jan 9.
59 Glutathione S-transferases (GSTs) inhibit transcriptional activation by the peroxisomal proliferator-activated receptor gamma (PPAR gamma) ligand, 15-deoxy-delta 12,14prostaglandin J2 (15-d-PGJ2). Biochemistry. 2004 Mar 2;43(8):2345-52. doi: 10.1021/bi035936+.
60 ATP-binding cassette transporters as pitfalls in selection of transgenic cells. Anal Biochem. 2010 Apr 15;399(2):246-50. doi: 10.1016/j.ab.2009.12.014. Epub 2009 Dec 14.
61 Intestinal breast cancer resistance protein (BCRP)/Bcrp1 and multidrug resistance protein 3 (MRP3)/Mrp3 are involved in the pharmacokinetics of resveratrol. Mol Pharmacol. 2009 Apr;75(4):876-85. doi: 10.1124/mol.108.052019. Epub 2008 Dec 29.