Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCP6XGZ)

• DOT Name: Early growth response protein 1 (EGR1)
• Synonyms: EGR-1; AT225; Nerve growth factor-induced protein A; NGFI-A; Transcription factor ETR103; Transcription factor Zif268; Zinc finger protein 225; Zinc finger protein Krox-24
• Gene Name: EGR1
• UniProt ID: EGR1_HUMAN
• PDB ID: 4R2A; 4R2C; 4R2D; 4X9J; 5N14
• Pfam ID: PF11914 ; PF11928 ; PF00096
• Sequence:
  MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGS
  NSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETS
  YPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAAS
  SASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAY
  PAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG
  SQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIR
  IHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
  QKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSS
  TYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTI
  EIC
• Function: Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3'(EGR-site) in the promoter region of target genes. Binds double-stranded target DNA, irrespective of the cytosine methylation status. Regulates the transcription of numerous target genes, and thereby plays an important role in regulating the response to growth factors, DNA damage, and ischemia. Plays a role in the regulation of cell survival, proliferation and cell death. Activates expression of p53/TP53 and TGFB1, and thereby helps prevent tumor formation. Required for normal progress through mitosis and normal proliferation of hepatocytes after partial hepatectomy. Mediates responses to ischemia and hypoxia; regulates the expression of proteins such as IL1B and CXCL2 that are involved in inflammatory processes and development of tissue damage after ischemia. Regulates biosynthesis of luteinizing hormone (LHB) in the pituitary. Regulates the amplitude of the expression rhythms of clock genes: BMAL1, PER2 and NR1D1 in the liver via the activation of PER1 (clock repressor) transcription. Regulates the rhythmic expression of core-clock gene BMAL1 in the suprachiasmatic nucleus (SCN).
• Tissue Specificity: Detected in neutrophils (at protein level).
• KEGG Pathway:
  Apelin sig.ling pathway (hsa04371)
  GnRH sig.ling pathway (hsa04912)
  Parathyroid hormone synthesis, secretion and action (hsa04928)
  AGE-RAGE sig.ling pathway in diabetic complications (hsa04933)
  Prion disease (hsa05020)
  Human T-cell leukemia virus 1 infection (hsa05166)
• Reactome Pathway:
  NGF-stimulated transcription (R-HSA-9031628)
  Interferon alpha/beta signaling (R-HSA-909733)
  Regulation of PTEN gene transcription (R-HSA-8943724)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitoxantrone	DMM39BF	Approved	Early growth response protein 1 (EGR1) affects the response to substance of Mitoxantrone.	[81]
Chloroxine	DMFZBMQ	Approved	Early growth response protein 1 (EGR1) increases the Apoptosis ADR of Chloroxine.	[82]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Early growth response protein 1 (EGR1).	[1]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Early growth response protein 1 (EGR1).	[63]

85 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Early growth response protein 1 (EGR1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Early growth response protein 1 (EGR1).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Early growth response protein 1 (EGR1).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Early growth response protein 1 (EGR1).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Early growth response protein 1 (EGR1).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Early growth response protein 1 (EGR1).	[7]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Early growth response protein 1 (EGR1).	[8]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Early growth response protein 1 (EGR1).	[9]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Early growth response protein 1 (EGR1).	[10]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Early growth response protein 1 (EGR1).	[11]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Early growth response protein 1 (EGR1).	[12]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Early growth response protein 1 (EGR1).	[13]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Early growth response protein 1 (EGR1).	[14]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Early growth response protein 1 (EGR1).	[13]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Early growth response protein 1 (EGR1).	[15]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Early growth response protein 1 (EGR1).	[16]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Early growth response protein 1 (EGR1).	[17]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Early growth response protein 1 (EGR1).	[18]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Early growth response protein 1 (EGR1).	[19]
Menadione	DMSJDTY	Approved	Menadione increases the expression of Early growth response protein 1 (EGR1).	[12]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Early growth response protein 1 (EGR1).	[20]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Early growth response protein 1 (EGR1).	[21]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Early growth response protein 1 (EGR1).	[22]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Early growth response protein 1 (EGR1).	[23]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Early growth response protein 1 (EGR1).	[24]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Early growth response protein 1 (EGR1).	[25]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Early growth response protein 1 (EGR1).	[26]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Early growth response protein 1 (EGR1).	[27]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Early growth response protein 1 (EGR1).	[28]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of Early growth response protein 1 (EGR1).	[29]
Diclofenac	DMPIHLS	Approved	Diclofenac increases the expression of Early growth response protein 1 (EGR1).	[30]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Early growth response protein 1 (EGR1).	[31]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Early growth response protein 1 (EGR1).	[32]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Early growth response protein 1 (EGR1).	[30]
Mitomycin	DMH0ZJE	Approved	Mitomycin increases the expression of Early growth response protein 1 (EGR1).	[33]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol increases the expression of Early growth response protein 1 (EGR1).	[34]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Early growth response protein 1 (EGR1).	[20]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide increases the expression of Early growth response protein 1 (EGR1).	[35]
Dihydroartemisinin	DMBXVMZ	Approved	Dihydroartemisinin increases the expression of Early growth response protein 1 (EGR1).	[36]
Dihydroxyacetone	DMM1LG2	Approved	Dihydroxyacetone affects the expression of Early growth response protein 1 (EGR1).	[37]
Penicillamine	DM40EF6	Approved	Penicillamine increases the expression of Early growth response protein 1 (EGR1).	[38]
Sanguinarine	DMDINFS	Approved	Sanguinarine decreases the expression of Early growth response protein 1 (EGR1).	[39]
Gallium nitrate	DMF9O6B	Approved	Gallium nitrate increases the expression of Early growth response protein 1 (EGR1).	[40]
Betamethasone	DMAHJEF	Approved	Betamethasone affects the expression of Early growth response protein 1 (EGR1).	[41]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Early growth response protein 1 (EGR1).	[42]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Early growth response protein 1 (EGR1).	[43]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Early growth response protein 1 (EGR1).	[44]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Early growth response protein 1 (EGR1).	[45]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Early growth response protein 1 (EGR1).	[46]
Rigosertib	DMOSTXF	Phase 3	Rigosertib affects the expression of Early growth response protein 1 (EGR1).	[47]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Early growth response protein 1 (EGR1).	[48]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Early growth response protein 1 (EGR1).	[49]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Early growth response protein 1 (EGR1).	[50]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Early growth response protein 1 (EGR1).	[51]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Early growth response protein 1 (EGR1).	[52]
PEITC	DMOMN31	Phase 2	PEITC increases the expression of Early growth response protein 1 (EGR1).	[53]
R-roscovitine	DMSH108	Phase 2	R-roscovitine decreases the expression of Early growth response protein 1 (EGR1).	[54]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Early growth response protein 1 (EGR1).	[55]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Early growth response protein 1 (EGR1).	[56]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Early growth response protein 1 (EGR1).	[57]
GSK2816126	DMJDVW4	Phase 1	GSK2816126 increases the expression of Early growth response protein 1 (EGR1).	[58]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Early growth response protein 1 (EGR1).	[59]
Flavonoid derivative 1	DMCQP0B	Patented	Flavonoid derivative 1 increases the expression of Early growth response protein 1 (EGR1).	[60]
Clioquinol	DM746BZ	Withdrawn from market	Clioquinol increases the expression of Early growth response protein 1 (EGR1).	[61]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Early growth response protein 1 (EGR1).	[62]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Early growth response protein 1 (EGR1).	[64]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Early growth response protein 1 (EGR1).	[65]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Early growth response protein 1 (EGR1).	[66]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Early growth response protein 1 (EGR1).	[67]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Early growth response protein 1 (EGR1).	[68]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Early growth response protein 1 (EGR1).	[69]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the expression of Early growth response protein 1 (EGR1).	[8]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid increases the expression of Early growth response protein 1 (EGR1).	[70]
D-glucose	DMMG2TO	Investigative	D-glucose increases the expression of Early growth response protein 1 (EGR1).	[71]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Early growth response protein 1 (EGR1).	[72]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE increases the expression of Early growth response protein 1 (EGR1).	[73]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde increases the expression of Early growth response protein 1 (EGR1).	[74]
Forskolin	DM6ITNG	Investigative	Forskolin decreases the expression of Early growth response protein 1 (EGR1).	[28]
Okadaic acid	DM47CO1	Investigative	Okadaic acid increases the expression of Early growth response protein 1 (EGR1).	[75]
acrolein	DMAMCSR	Investigative	acrolein increases the expression of Early growth response protein 1 (EGR1).	[76]
Arachidonic acid	DMUOQZD	Investigative	Arachidonic acid increases the expression of Early growth response protein 1 (EGR1).	[77]
U0126	DM31OGF	Investigative	U0126 decreases the expression of Early growth response protein 1 (EGR1).	[78]
PD98059	DMZC90M	Investigative	PD98059 decreases the expression of Early growth response protein 1 (EGR1).	[79]
Pyrrolidine dithiocarbamate	DM5ZAS6	Investigative	Pyrrolidine dithiocarbamate increases the expression of Early growth response protein 1 (EGR1).	[44]
PAF	DMRZAQW	Investigative	PAF increases the expression of Early growth response protein 1 (EGR1).	[80]

References

• [1] Nuclear and Mitochondrial DNA Methylation Patterns Induced by Valproic Acid in Human Hepatocytes. Chem Res Toxicol. 2017 Oct 16;30(10):1847-1854. doi: 10.1021/acs.chemrestox.7b00171. Epub 2017 Sep 13.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] The retinoid anticancer signal: mechanisms of target gene regulation. Br J Cancer. 2005 Aug 8;93(3):310-8. doi: 10.1038/sj.bjc.6602700.
• [4] Gene expression data from acetaminophen-induced toxicity in human hepatic in vitro systems and clinical liver samples. Data Brief. 2016 Mar 26;7:1052-1057. doi: 10.1016/j.dib.2016.03.069. eCollection 2016 Jun.
• [5] Cell-type-specific responses to chemotherapeutics in breast cancer. Cancer Res. 2004 Jun 15;64(12):4218-26.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [8] Alteration of estrogen-regulated gene expression in human cells induced by the agricultural and horticultural herbicide glyphosate. Hum Exp Toxicol. 2007 Sep;26(9):747-52. doi: 10.1177/0960327107083453.
• [9] Activation of inflammation/NF-kappaB signaling in infants born to arsenic-exposed mothers. PLoS Genet. 2007 Nov;3(11):e207.
• [10] Quercetin and Its Fermented Extract as a Potential Inhibitor of Bisphenol A-Exposed HT-29 Colon Cancer Cells' Viability. Int J Mol Sci. 2023 Mar 15;24(6):5604. doi: 10.3390/ijms24065604.
• [11] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [12] Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
• [13] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [14] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [15] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [16] Characterization of DOK1, a candidate tumor suppressor gene, in epithelial ovarian cancer. Mol Oncol. 2011 Oct;5(5):438-53. doi: 10.1016/j.molonc.2011.07.003. Epub 2011 Jul 26.
• [17] Gene expression changes in human small airway epithelial cells exposed to Delta9-tetrahydrocannabinol. Toxicol Lett. 2005 Aug 14;158(2):95-107.
• [18] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [19] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [20] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [21] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [22] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [23] Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
• [24] Synergistic antiproliferative effect of arsenic trioxide combined with bortezomib in HL60 cell line and primary blasts from patients affected by myeloproliferative disorders. Cancer Genet Cytogenet. 2010 Jun;199(2):110-20. doi: 10.1016/j.cancergencyto.2010.02.010.
• [25] Increased sensitivity for troglitazone-induced cytotoxicity using a human in vitro co-culture model. Toxicol In Vitro. 2009 Oct;23(7):1387-95.
• [26] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [27] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [28] cAMP/PKA/EGR1 signaling mediates the molecular mechanism of ethanol-induced inhibition of placental 11beta-HSD2 expression. Toxicol Appl Pharmacol. 2018 Aug 1;352:77-86.
• [29] In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
• [30] Cyclooxygenase inhibitors induce the expression of the tumor suppressor gene EGR-1, which results in the up-regulation of NAG-1, an antitumorigenic protein. Mol Pharmacol. 2005 Feb;67(2):356-64. doi: 10.1124/mol.104.005108. Epub 2004 Oct 27.
• [31] nAChRs-ERK1/2-Egr-1 signaling participates in the developmental toxicity of nicotine by epigenetically down-regulating placental 11beta-HSD2. Toxicol Appl Pharmacol. 2018 Apr 1;344:1-12.
• [32] Identification of cornifelin and early growth response-1 gene as novel biomarkers for in vitro eye irritation using a 3D reconstructed human cornea model MCTT HCE?. Arch Toxicol. 2015 Sep;89(9):1589-98. doi: 10.1007/s00204-014-1390-8. Epub 2014 Nov 7.
• [33] Genomic and proteomic profiling of responses to toxic metals in human lung cells. Environ Health Perspect. 2003 May;111(6):825-35.
• [34] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [35] Genomic profiling uncovers a molecular pattern for toxicological characterization of mutagens and promutagens in vitro. Toxicol Sci. 2011 Jul;122(1):185-97.
• [36] The redox antimalarial dihydroartemisinin targets human metastatic melanoma cells but not primary melanocytes with induction of NOXA-dependent apoptosis. Invest New Drugs. 2012 Aug;30(4):1289-301. doi: 10.1007/s10637-011-9676-7. Epub 2011 May 6.
• [37] The sunless tanning agent dihydroxyacetone induces stress response gene expression and signaling in cultured human keratinocytes and reconstructed epidermis. Redox Biol. 2020 Sep;36:101594. doi: 10.1016/j.redox.2020.101594. Epub 2020 May 29.
• [38] D-Penicillamine targets metastatic melanoma cells with induction of the unfolded protein response (UPR) and Noxa (PMAIP1)-dependent mitochondrial apoptosis. Apoptosis. 2012 Oct;17(10):1079-94.
• [39] Sanguinarine induces apoptosis in human colorectal cancer HCT-116 cells through ROS-mediated Egr-1 activation and mitochondrial dysfunction. Toxicol Lett. 2013 Jul 4;220(2):157-66. doi: 10.1016/j.toxlet.2013.04.020. Epub 2013 May 6.
• [40] Role of oxidative stress in the induction of metallothionein-2A and heme oxygenase-1 gene expression by the antineoplastic agent gallium nitrate in human lymphoma cells. Free Radic Biol Med. 2008 Sep 15;45(6):763-72.
• [41] [Steroid drugs and GM-CSF modulates activity of Egr-1 in glioma cells]. Cir Cir. 2013 Jan-Feb;81(1):3-13.
• [42] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [43] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [44] Antioxidants induce different phenotypes by a distinct modulation of signal transduction. FEBS Lett. 2002 Dec 18;532(3):289-94. doi: 10.1016/s0014-5793(02)03683-9.
• [45] Integrated transcriptomic and metabolomic analyses to characterize the anti-cancer effects of (-)-epigallocatechin-3-gallate in human colon cancer cells. Toxicol Appl Pharmacol. 2020 Aug 15;401:115100. doi: 10.1016/j.taap.2020.115100. Epub 2020 Jun 6.
• [46] Curcumin downregulates the inflammatory cytokines CXCL1 and -2 in breast cancer cells via NFkappaB. Carcinogenesis. 2008 Apr;29(4):779-89.
• [47] ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
• [48] A high concentration of genistein down-regulates activin A, Smad3 and other TGF-beta pathway genes in human uterine leiomyoma cells. Exp Mol Med. 2012 Apr 30;44(4):281-92.
• [49] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [50] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [51] Estrogenic GPR30 signalling induces proliferation and migration of breast cancer cells through CTGF. EMBO J. 2009 Mar 4;28(5):523-32.
• [52] A role for serine proteases in mediating phorbol ester-induced differentiation of HL-60 cells. Exp Cell Res. 2000 Apr 10;256(1):264-71. doi: 10.1006/excr.2000.4821.
• [53] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [54] Aryl hydrocarbon receptor-dependent up-regulation of the heterodimeric amino acid transporter LAT1 (SLC7A5)/CD98hc (SLC3A2) by diesel exhaust particle extract in human bronchial epithelial cells. Toxicol Appl Pharmacol. 2016 Jan 1;290:74-85.
• [55] Transcriptional signatures of environmentally relevant exposures in normal human mammary epithelial cells: benzo[a]pyrene. Cancer Lett. 2005 Apr 28;221(2):201-11.
• [56] BET bromodomain inhibition as a novel strategy for reactivation of HIV-1. J Leukoc Biol. 2012 Dec;92(6):1147-54. doi: 10.1189/jlb.0312165. Epub 2012 Jul 16.
• [57] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [58] Epigenetic control of skeletal development by the histone methyltransferase Ezh2. J Biol Chem. 2015 Nov 13;290(46):27604-17.
• [59] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [60] Cytotoxicity of flavones and flavonols to a human esophageal squamous cell carcinoma cell line (KYSE-510) by induction of G2/M arrest and apoptosis. Toxicol In Vitro. 2009 Aug;23(5):797-807. doi: 10.1016/j.tiv.2009.04.007. Epub 2009 May 3.
• [61] Identification of chemical compounds that induce HIF-1alpha activity. Toxicol Sci. 2009 Nov;112(1):153-63.
• [62] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [63] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [64] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [65] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [66] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [67] In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
• [68] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [69] Cytotoxicity and gene array analysis of alveolar epithelial A549 cells exposed to paraquat. Chem Biol Interact. 2010 Dec 5;188(3):427-36.
• [70] Roles of acyl-CoA synthetase long-chain family member 5 and colony stimulating factor 2 in inhibition of palmitic or stearic acids in lung cancer cell proliferation and metabolism. Cell Biol Toxicol. 2021 Feb;37(1):15-34. doi: 10.1007/s10565-020-09520-w. Epub 2020 Apr 28.
• [71] High ambient glucose augments angiotensin II-induced proinflammatory gene mRNA expression in human mesangial cells: effects of valsartan and simvastatin. Am J Nephrol. 2009;30(2):99-111.
• [72] Microarray Analysis of Gene Expression Alteration in Human Middle Ear Epithelial Cells Induced by Asian Sand Dust. Clin Exp Otorhinolaryngol. 2015 Dec;8(4):345-53. doi: 10.3342/ceo.2015.8.4.345. Epub 2015 Nov 10.
• [73] Preferential induction of the AhR gene battery in HepaRG cells after a single or repeated exposure to heterocyclic aromatic amines. Toxicol Appl Pharmacol. 2010 Nov 15;249(1):91-100.
• [74] The cinnamon-derived Michael acceptor cinnamic aldehyde impairs melanoma cell proliferation, invasiveness, and tumor growth. Free Radic Biol Med. 2009 Jan 15;46(2):220-31.
• [75] Whole genome mRNA transcriptomics analysis reveals different modes of action of the diarrheic shellfish poisons okadaic acid and dinophysis toxin-1 versus azaspiracid-1 in Caco-2 cells. Toxicol In Vitro. 2018 Feb;46:102-112.
• [76] Toxicity of smoke extracts towards A549 lung cells: role of acrolein and suppression by carbonyl scavengers. Chem Biol Interact. 2010 Feb 12;183(3):416-24.
• [77] Arachidonic acid-induced gene expression in colon cancer cells. Carcinogenesis. 2006 Oct;27(10):1950-60.
• [78] Phosphorylation of histone H3 at serine 10 has an essential role in arsenite-induced expression of FOS, EGR1 and IL8 mRNA in cultured human cell lines. J Appl Toxicol. 2013 Aug;33(8):746-55. doi: 10.1002/jat.2724. Epub 2012 Feb 21.
• [79] The egr-1 gene is induced by DNA-damaging agents and non-genotoxic drugs in both normal and neoplastic human cells. Life Sci. 2003 May 16;72(26):2975-92. doi: 10.1016/s0024-3205(03)00230-3.
• [80] Oxidized phospholipid: POVPC binds to platelet-activating-factor receptor on human macrophagesImplications in atherosclerosis. Atherosclerosis. 2006 Oct;188(2):433-43.
• [81] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [82] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.