Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFHXMON)

• DOT Name: Filamin-binding LIM protein 1 (FBLIM1)
• Synonyms: FBLP-1; Migfilin; Mitogen-inducible 2-interacting protein; MIG2-interacting protein
• Gene Name: FBLIM1
• Related Disease:
  Nephropathy
  Thyroid gland carcinoma
  Thyroid tumor
  Type-1/2 diabetes
  Acute lymphocytic leukaemia
  Advanced cancer
  B-cell neoplasm
  Carcinoma of esophagus
  Childhood acute lymphoblastic leukemia
  Chronic recurrent multifocal osteomyelitis
  Colorectal carcinoma
  Epilepsy
  Esophageal cancer
  Glioma
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  Kindler syndrome
  Mantle cell lymphoma
  Metastatic malignant neoplasm
  Neoplasm
  Neoplasm of esophagus
  Non-hodgkin lymphoma
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Oral cancer
  Osteoarthritis
  Osteosarcoma
  Plasma cell myeloma
  Thyroid cancer
  Thyroid gland undifferentiated (anaplastic) carcinoma
  Triple negative breast cancer
  Vasculitis
  Small lymphocytic lymphoma
  Bone osteosarcoma
  Autism spectrum disorder
  Breast cancer
  Breast carcinoma
  leukaemia
  Leukemia
  Majeed syndrome
  Neurodevelopmental disorder
  Squamous cell carcinoma
• UniProt ID: FBLI1_HUMAN
• PDB ID: 2K9U; 2W0P; 4P3W
• Pfam ID: PF00412
• Sequence:
  MASKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWEAPAPMKTPEAGLAGRP
  SPWTTPGRAAATVPAAPMQLFNGGCPPPPPVLDGEDVLPDLDLLPPPPPPPPVLLPSEEE
  APAPMGASLIADLEQLHLSPPPPPPQAPAEGPSVQPGPLRPMEEELPPPPAEPVEKGAST
  DICAFCHKTVSPRELAVEAMKRQYHAQCFTCRTCRRQLAGQSFYQKDGRPLCEPCYQDTL
  ERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCIGDESFALGSQNEVYCLDDFYRKFA
  PVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLNNHLFC
  KPCHVKRSAAGCC
• Function: Serves as an anchoring site for cell-ECM adhesion proteins and filamin-containing actin filaments. Is implicated in cell shape modulation (spreading) and motility. May participate in the regulation of filamin-mediated cross-linking and stabilization of actin filaments. May also regulate the assembly of filamin-containing signaling complexes that control actin assembly. Promotes dissociation of FLNA from ITGB3 and ITGB7. Promotes activation of integrins and regulates integrin-mediated cell-cell adhesion.
• Tissue Specificity: Isoform 1 and isoform 3 are expressed in heart, kidney, lung, pancreas, placenta and platelets. Isoform 2 is expressed in brain, heart, kidney, lung, pancreas, placenta, skeletal muscle and platelets.
• Reactome Pathway: Cell-extracellular matrix interactions (R-HSA-446353)

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Nephropathy	DISXWP4P	Definitive	Biomarker	[1]
Thyroid gland carcinoma	DISMNGZ0	Definitive	Altered Expression	[2]
Thyroid tumor	DISLVKMD	Definitive	Altered Expression	[2]
Type-1/2 diabetes	DISIUHAP	Definitive	Genetic Variation	[3]
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
B-cell neoplasm	DISVY326	Strong	Altered Expression	[6]
Carcinoma of esophagus	DISS6G4D	Strong	Biomarker	[7]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Biomarker	[4]
Chronic recurrent multifocal osteomyelitis	DIST1OU2	Strong	Genetic Variation	[8]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[9]
Epilepsy	DISBB28L	Strong	Biomarker	[10]
Esophageal cancer	DISGB2VN	Strong	Biomarker	[7]
Glioma	DIS5RPEH	Strong	Biomarker	[11]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[12]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[13]
Kindler syndrome	DIS8AP9J	Strong	Biomarker	[14]
Mantle cell lymphoma	DISFREOV	Strong	Altered Expression	[15]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[16]
Neoplasm	DISZKGEW	Strong	Biomarker	[17]
Neoplasm of esophagus	DISOLKAQ	Strong	Biomarker	[7]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Biomarker	[18]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[19]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[20]
Oral cancer	DISLD42D	Strong	Biomarker	[21]
Osteoarthritis	DIS05URM	Strong	Biomarker	[22]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[23]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[24]
Thyroid cancer	DIS3VLDH	Strong	Altered Expression	[2]
Thyroid gland undifferentiated (anaplastic) carcinoma	DISYBB1W	Strong	Biomarker	[25]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[26]
Vasculitis	DISQRKDX	Strong	Altered Expression	[27]
Small lymphocytic lymphoma	DIS30POX	moderate	Biomarker	[28]
Bone osteosarcoma	DIST1004	Disputed	Biomarker	[23]
Autism spectrum disorder	DISXK8NV	Limited	Genetic Variation	[29]
Breast cancer	DIS7DPX1	Limited	Genetic Variation	[30]
Breast carcinoma	DIS2UE88	Limited	Genetic Variation	[30]
leukaemia	DISS7D1V	Limited	Biomarker	[31]
Leukemia	DISNAKFL	Limited	Biomarker	[31]
Majeed syndrome	DIS8AI2U	Limited	Biomarker	[32]
Neurodevelopmental disorder	DIS372XH	Limited	Biomarker	[29]
Squamous cell carcinoma	DISQVIFL	Limited	Biomarker	[33]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Filamin-binding LIM protein 1 (FBLIM1).	[34]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Filamin-binding LIM protein 1 (FBLIM1).	[35]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Filamin-binding LIM protein 1 (FBLIM1).	[36]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Filamin-binding LIM protein 1 (FBLIM1).	[37]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Filamin-binding LIM protein 1 (FBLIM1).	[38]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Filamin-binding LIM protein 1 (FBLIM1).	[39]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Filamin-binding LIM protein 1 (FBLIM1).	[40]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Filamin-binding LIM protein 1 (FBLIM1).	[41]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Filamin-binding LIM protein 1 (FBLIM1).	[42]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Filamin-binding LIM protein 1 (FBLIM1).	[43]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Filamin-binding LIM protein 1 (FBLIM1).	[44]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Filamin-binding LIM protein 1 (FBLIM1).	[45]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Filamin-binding LIM protein 1 (FBLIM1).	[46]

References

• [1] Molecular analysis of SV-40-CAL, a new slow growing SV-40 strain from the kidney of a caged New World monkey with fatal renal disease.Virus Genes. 2004 Oct;29(2):183-90. doi: 10.1023/B:VIRU.0000036378.42136.7c.
• [2] Long non-coding RNA BANCR regulates cancer stem cell markers in papillary thyroid cancer via the RAF/MEK/ERK signaling pathway.Oncol Rep. 2018 Aug;40(2):859-866. doi: 10.3892/or.2018.6502. Epub 2018 Jun 18.
• [3] Diabetic bone lesions: a study on 38 known modern skeletons and the implications for forensic scenarios.Int J Legal Med. 2019 Jul;133(4):1225-1239. doi: 10.1007/s00414-018-1870-0. Epub 2018 Jun 2.
• [4] PI3K- inhibition using CAL-101 exerts apoptotic effects and increases doxorubicin-induced cell death in pre-B-acute lymphoblastic leukemia cells.Anticancer Drugs. 2017 Apr;28(4):436-445. doi: 10.1097/CAD.0000000000000477.
• [5] Inhibition of Cancer Stem-Like Phenotype by Curcumin and Deguelin in CAL-62 Anaplastic Thyroid Cancer Cells.Anticancer Agents Med Chem. 2019;19(15):1887-1898. doi: 10.2174/1871520619666191004144025.
• [6] PI3K activates E2F1 synthesis in response to mRNA translation stress.Nat Commun. 2017 Dec 13;8(1):2103. doi: 10.1038/s41467-017-02282-w.
• [7] Migfilin regulates esophageal cancer cell motility through promoting GSK-3-mediated degradation of -catenin.Mol Cancer Res. 2012 Mar;10(3):273-81. doi: 10.1158/1541-7786.MCR-11-0419. Epub 2012 Jan 13.
• [8] Correction: Recessive coding and regulatory mutations in FBLIM1 underlie the pathogenesis of chronic recurrent multifocal osteomyelitis (CRMO).PLoS One. 2017 Jul 7;12(7):e0181222. doi: 10.1371/journal.pone.0181222. eCollection 2017.
• [9] The effect of age on anastomotic leakage in colorectal cancer surgery: A population-based study.J Surg Oncol. 2018 Jul;118(1):113-120. doi: 10.1002/jso.25108. Epub 2018 Jun 7.
• [10] Valproic acid, a histone deacetylase inhibitor, enhances sensitivity to doxorubicin in anaplastic thyroid cancer cells.J Endocrinol. 2006 Nov;191(2):465-72. doi: 10.1677/joe.1.06970.
• [11] Migfilin promotes migration and invasion in glioma by driving EGFR and MMP-2 signalings: A positive feedback loop regulation.J Genet Genomics. 2017 Dec 20;44(12):557-565. doi: 10.1016/j.jgg.2017.09.008. Epub 2017 Oct 16.
• [12] Gold nanoclusters as a contrast agent for image-guided surgery of head and neck tumors.Nanomedicine. 2019 Aug;20:102011. doi: 10.1016/j.nano.2019.04.014. Epub 2019 May 17.
• [13] circFBLIM1 act as a ceRNA to promote hepatocellular cancer progression by sponging miR-346.J Exp Clin Cancer Res. 2018 Jul 27;37(1):172. doi: 10.1186/s13046-018-0838-8.
• [14] Localization and potential function of kindlin-1 in periodontal tissues.Eur J Oral Sci. 2009 Oct;117(5):518-27. doi: 10.1111/j.1600-0722.2009.00651.x.
• [15] Mantle cell lymphoma: 2012 update on diagnosis, risk-stratification, and clinical management.Am J Hematol. 2012 Jun;87(6):604-9. doi: 10.1002/ajh.23176.
• [16] Human breast-cancer metastasis formation in a nude-mouse model: studies of hyaluronidase, hyaluronan and hyaluronan-binding sites in metastatic cells.Int J Cancer. 1999 Jul 2;82(1):77-83. doi: 10.1002/(sici)1097-0215(19990702)82:1<77::aid-ijc14>3.0.co;2-q.
• [17] LY303511 displays antiproliferation potential against oral cancer cells in vitro and in vivo.Environ Toxicol. 2019 Aug;34(8):958-967. doi: 10.1002/tox.22767. Epub 2019 May 21.
• [18] Combining CAL-101 with Celecoxib Enhances Apoptosis of EBV-transformed B-Cells Through MAPK-induced ER Stress.Anticancer Res. 2015 May;35(5):2699-708.
• [19] Upregulation of proteins of the NLRP3 inflammasome in patients with periodontitis and uncontrolled type 2 diabetes.Oral Dis. 2019 Mar;25(2):596-608. doi: 10.1111/odi.13003. Epub 2018 Dec 16.
• [20] TMEM158 and FBLP1 as novel marker genes of cisplatin sensitivity in non-small cell lung cancer cells.Exp Lung Res. 2012 Nov;38(9-10):463-74. doi: 10.3109/01902148.2012.731625.
• [21] FBLIM1 enhances oral cancer malignancy via modulation of the epidermal growth factor receptor pathway.Mol Carcinog. 2018 Dec;57(12):1690-1697. doi: 10.1002/mc.22889. Epub 2018 Sep 5.
• [22] Migfilin's elimination from osteoarthritic chondrocytes further promotes the osteoarthritic phenotype via -catenin upregulation.Biochem Biophys Res Commun. 2013 Jan 11;430(2):494-9. doi: 10.1016/j.bbrc.2012.12.008. Epub 2012 Dec 10.
• [23] A Novel Fluorescence-Labeled Curcumin Conjugate: Synthesis, Evaluation and Imaging on Human Cell Lines.Curr Pharm Des. 2018;24(16):1821-1826. doi: 10.2174/1381612824666180406103317.
• [24] PI3K/p110{delta} is a novel therapeutic target in multiple myeloma.Blood. 2010 Sep 2;116(9):1460-8. doi: 10.1182/blood-2009-06-222943. Epub 2010 May 26.
• [25] Anti-hTERT siRNA-Loaded Nanoparticles Block the Growth of Anaplastic Thyroid Cancer Xenograft.Mol Cancer Ther. 2018 Jun;17(6):1187-1195. doi: 10.1158/1535-7163.MCT-17-0559. Epub 2018 Mar 21.
• [26] The Chk1 inhibitor MK-8776 increases the radiosensitivity of human triple-negative breast cancer by inhibiting autophagy.Acta Pharmacol Sin. 2017 Apr;38(4):513-523. doi: 10.1038/aps.2016.136. Epub 2017 Jan 2.
• [27] Serum levels of C1q/tumor necrosis factor-related protein-1 in children with Kawasaki disease.Pediatr Res. 2018 May;83(5):999-1003. doi: 10.1038/pr.2018.16. Epub 2018 May 9.
• [28] The role of phosphatidylinositol 3-kinase- in the immunomodulatory effects of lenalidomide in chronic lymphocytic leukemia.Blood. 2011 Apr 21;117(16):4323-7. doi: 10.1182/blood-2010-11-315705. Epub 2011 Mar 4.
• [29] Possible involvement of a cell adhesion molecule, Migfilin, in brain development and pathogenesis of autism spectrum disorders.J Neurosci Res. 2018 May;96(5):789-802. doi: 10.1002/jnr.24194. Epub 2017 Nov 8.
• [30] The appearance of breast cancer metastases on dry bone: Implications for forensic anthropology.J Forensic Leg Med. 2019 Feb;61:5-12. doi: 10.1016/j.jflm.2018.10.007. Epub 2018 Oct 25.
• [31] Synergistic Effects of PI3K and c-Myc Co-targeting in Acute Leukemia: Shedding New Light on Resistance to Selective PI3K- Inhibitor CAL-101.Cancer Invest. 2019;37(7):311-324. doi: 10.1080/07357907.2019.1651328. Epub 2019 Aug 14.
• [32] Update on the genetics of nonbacterial osteomyelitis in humans.Curr Opin Rheumatol. 2018 Sep;30(5):521-525. doi: 10.1097/BOR.0000000000000530.
• [33] Quantitative Analysis of [(18)F]FMISO PET for Tumor Hypoxia: Correlation of Modeling Results with Immunohistochemistry.Mol Imaging Biol. 2017 Feb;19(1):120-129. doi: 10.1007/s11307-016-0975-4.
• [34] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [35] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [36] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [37] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [38] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [39] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [40] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [41] Zoledronate dysregulates fatty acid metabolism in renal tubular epithelial cells to induce nephrotoxicity. Arch Toxicol. 2018 Jan;92(1):469-485.
• [42] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [43] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [44] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [45] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [46] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.