Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTI7WBZV)

• DOT Name: Nucleosome assembly protein 1-like 1 (NAP1L1)
• Synonyms: NAP-1-related protein; hNRP
• Gene Name: NAP1L1
• Related Disease:
  Advanced cancer
  Neuroblastoma
  Alzheimer disease
  Astrocytoma
  Brain neoplasm
  Carcinoma
  Diabetic macular edema
  Emery-Dreifuss muscular dystrophy 2, autosomal dominant
  Hepatitis C virus infection
  Hypophosphatemia
  Idiopathic thrombocytopenic purpura
  Immunodeficiency
  Interstitial cystitis
  Metastatic malignant neoplasm
  Neoplasm
  Non-small-cell lung cancer
  Prostate cancer
  Psoriasis
  Thiel-Behnke corneal dystrophy
  Breast cancer
  Breast carcinoma
  Hepatocellular carcinoma
  T-cell acute lymphoblastic leukaemia
  Adult glioblastoma
  Amyotrophic lateral sclerosis
  Colorectal carcinoma
  Glioblastoma multiforme
  Glioma
  Prostate carcinoma
• UniProt ID: NP1L1_HUMAN
• PDB ID: 7BP5; 7UN3; 7UN6
• Pfam ID: PF00956
• Sequence:
  MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLV
  ETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEI
  INAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDL
  LSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPD
  DSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNF
  FAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEE
  ADEEGEEEGDEENDPDYDPKKDQNPAECKQQ
• Function: Histone chaperone that plays a role in the nuclear import of H2A-H2B and nucleosome assembly. Participates also in several important DNA repair mechanisms: greatly enhances ERCC6-mediated chromatin remodeling which is essential for transcription-coupled nucleotide excision DNA repair. Stimulates also homologous recombination (HR) by RAD51 and RAD54 which is essential in mitotic DNA double strand break (DSB) repair. Plays a key role in the regulation of embryonic neurogenesis. Promotes the proliferation of neural progenitors and inhibits neuronal differentiation during cortical development. Regulates neurogenesis via the modulation of RASSF10; regulates RASSF10 expression by promoting SETD1A-mediated H3K4 methylation at the RASSF10 promoter; (Microbial infection) Positively regulates Epstein-Barr virus reactivation in epithelial cells through the induction of viral BZLF1 expression; (Microbial infection) Together with human herpesvirus 8 protein LANA1, assists the proper assembly of the nucleosome on the replicated viral DNA.
• Tissue Specificity: Ubiquitously expressed.

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Definitive	Biomarker	[1]
Neuroblastoma	DISVZBI4	Definitive	Biomarker	[2]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[3]
Astrocytoma	DISL3V18	Strong	Altered Expression	[4]
Brain neoplasm	DISY3EKS	Strong	Biomarker	[5]
Carcinoma	DISH9F1N	Strong	Biomarker	[6]
Diabetic macular edema	DIS162FN	Strong	Biomarker	[7]
Emery-Dreifuss muscular dystrophy 2, autosomal dominant	DIS4FT32	Strong	Altered Expression	[8]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[9]
Hypophosphatemia	DIS9DZYF	Strong	Altered Expression	[10]
Idiopathic thrombocytopenic purpura	DISFKGJU	Strong	Altered Expression	[11]
Immunodeficiency	DIS093I0	Strong	Biomarker	[12]
Interstitial cystitis	DIS7CAJA	Strong	Altered Expression	[13]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[14]
Neoplasm	DISZKGEW	Strong	Biomarker	[15]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[16]
Prostate cancer	DISF190Y	Strong	Biomarker	[17]
Psoriasis	DIS59VMN	Strong	Altered Expression	[18]
Thiel-Behnke corneal dystrophy	DIS3GK26	Strong	Biomarker	[19]
Breast cancer	DIS7DPX1	moderate	Biomarker	[20]
Breast carcinoma	DIS2UE88	moderate	Biomarker	[20]
Hepatocellular carcinoma	DIS0J828	moderate	Altered Expression	[21]
T-cell acute lymphoblastic leukaemia	DIS17AI2	Disputed	Biomarker	[22]
Adult glioblastoma	DISVP4LU	Limited	Altered Expression	[23]
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Altered Expression	[24]
Colorectal carcinoma	DIS5PYL0	Limited	Altered Expression	[25]
Glioblastoma multiforme	DISK8246	Limited	Altered Expression	[23]
Glioma	DIS5RPEH	Limited	Altered Expression	[26]
Prostate carcinoma	DISMJPLE	Limited	Genetic Variation	[27]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Etoposide	DMNH3PG	Approved	Nucleosome assembly protein 1-like 1 (NAP1L1) affects the response to substance of Etoposide.	[46]

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Nucleosome assembly protein 1-like 1 (NAP1L1).	[28]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Nucleosome assembly protein 1-like 1 (NAP1L1).	[29]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Nucleosome assembly protein 1-like 1 (NAP1L1).	[30]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Nucleosome assembly protein 1-like 1 (NAP1L1).	[31]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Nucleosome assembly protein 1-like 1 (NAP1L1).	[32]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Nucleosome assembly protein 1-like 1 (NAP1L1).	[33]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Nucleosome assembly protein 1-like 1 (NAP1L1).	[34]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Nucleosome assembly protein 1-like 1 (NAP1L1).	[35]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Nucleosome assembly protein 1-like 1 (NAP1L1).	[36]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Nucleosome assembly protein 1-like 1 (NAP1L1).	[37]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Nucleosome assembly protein 1-like 1 (NAP1L1).	[38]
Piroxicam	DMTK234	Approved	Piroxicam increases the expression of Nucleosome assembly protein 1-like 1 (NAP1L1).	[39]
Sulindac	DM2QHZU	Approved	Sulindac decreases the expression of Nucleosome assembly protein 1-like 1 (NAP1L1).	[40]
Ursodeoxycholic acid	DMCUT21	Approved	Ursodeoxycholic acid affects the expression of Nucleosome assembly protein 1-like 1 (NAP1L1).	[41]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene decreases the expression of Nucleosome assembly protein 1-like 1 (NAP1L1).	[30]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Nucleosome assembly protein 1-like 1 (NAP1L1).	[42]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Nucleosome assembly protein 1-like 1 (NAP1L1).	[44]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Nucleosome assembly protein 1-like 1 (NAP1L1).	[45]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid decreases the expression of Nucleosome assembly protein 1-like 1 (NAP1L1).	[36]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Nucleosome assembly protein 1-like 1 (NAP1L1).	[43]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Nucleosome assembly protein 1-like 1 (NAP1L1).	[43]

References

• [1] Neuropilin signalling in angiogenesis.Biochem Soc Trans. 2012 Feb;40(1):20-5. doi: 10.1042/BST20110689.
• [2] Nuclear matrix protein (NRP/B) modulates the nuclear factor (Erythroid-derived 2)-related 2 (NRF2)-dependent oxidative stress response.J Biol Chem. 2010 Aug 20;285(34):26190-8. doi: 10.1074/jbc.M109.095786. Epub 2010 May 28.
• [3] Isolation of hNap1BP which interacts with human Nap1 (NCKAP1) whose expression is down-regulated in Alzheimer's disease.Gene. 2001 Jun 27;271(2):159-69. doi: 10.1016/s0378-1119(01)00521-2.
• [4] Genomic organization, chromosomal localization and regulation of expression of the neuronal nuclear matrix protein NRP/B in human brain tumors.Gene. 2000 Sep 5;255(1):105-16. doi: 10.1016/s0378-1119(00)00297-3.
• [5] NRP/B mutations impair Nrf2-dependent NQO1 induction in human primary brain tumors.Oncogene. 2009 Jan 22;28(3):378-89. doi: 10.1038/onc.2008.396. Epub 2008 Nov 3.
• [6] Loss of responsiveness to transforming growth factor beta induces malignant transformation of nontumorigenic rat prostate epithelial cells.Cancer Res. 1999 Oct 1;59(19):4834-42.
• [7] Angiopoietin-like 4 binds neuropilins and cooperates with VEGF to induce diabetic macular edema.J Clin Invest. 2019 Nov 1;129(11):4593-4608. doi: 10.1172/JCI120879.
• [8] Nuclear envelope dystrophies show a transcriptional fingerprint suggesting disruption of Rb-MyoD pathways in muscle regeneration.Brain. 2006 Apr;129(Pt 4):996-1013. doi: 10.1093/brain/awl023. Epub 2006 Feb 14.
• [9] Hepatitis C Virus NS5A Targets Nucleosome Assembly Protein NAP1L1 To Control the Innate Cellular Response.J Virol. 2017 Aug 24;91(18):e00880-17. doi: 10.1128/JVI.00880-17. Print 2017 Sep 15.
• [10] Phosphatonin washout in Hyp mice proximal tubules: evidence for posttranscriptional regulation.Am J Physiol Renal Physiol. 2005 Feb;288(2):F363-70. doi: 10.1152/ajprenal.00217.2004. Epub 2004 Sep 28.
• [11] Thalidomide induce response in patients with corticosteroid-resistant or relapsed ITP by upregulating Neuropilin-1 expression.Int Immunopharmacol. 2019 Jul;72:437-444. doi: 10.1016/j.intimp.2019.04.041.
• [12] 17-Beta-estradiol induces neoplastic transformation in prostatic epithelial cells.Cancer Lett. 2011 May 1;304(1):8-20. doi: 10.1016/j.canlet.2011.01.003. Epub 2011 Feb 25.
• [13] Urothelial expression of neuropilins and VEGF receptors in control and interstitial cystitis patients.Am J Physiol Renal Physiol. 2008 Dec;295(6):F1613-23. doi: 10.1152/ajprenal.90344.2008. Epub 2008 Sep 24.
• [14] Predicting neuroendocrine tumor (carcinoid) neoplasia using gene expression profiling and supervised machine learning.Cancer. 2009 Apr 15;115(8):1638-50. doi: 10.1002/cncr.24180.
• [15] An Antibody Designed to Improve Adoptive NK-Cell Therapy Inhibits Pancreatic Cancer Progression in a Murine Model.Cancer Immunol Res. 2019 Feb;7(2):219-229. doi: 10.1158/2326-6066.CIR-18-0317. Epub 2018 Dec 4.
• [16] Nck-associated protein 1 associates with HSP90 to drive metastasis in human non-small-cell lung cancer.J Exp Clin Cancer Res. 2019 Mar 11;38(1):122. doi: 10.1186/s13046-019-1124-0.
• [17] Signal transducer and activator of transcription 3 (STAT3) activation in prostate cancer: Direct STAT3 inhibition induces apoptosis in prostate cancer lines.Mol Cancer Ther. 2004 Jan;3(1):11-20.
• [18] Upper keratinocytes of psoriatic skin lesions express high levels of NAP-1/IL-8 mRNA in situ.J Invest Dermatol. 1991 Jul;97(1):73-9. doi: 10.1111/1523-1747.ep12478128.
• [19] Development of a Novel Vaccine Containing Binary Toxin for the Prevention of Clostridium difficile Disease with Enhanced Efficacy against NAP1 Strains.PLoS One. 2017 Jan 26;12(1):e0170640. doi: 10.1371/journal.pone.0170640. eCollection 2017.
• [20] VEGF/NRP-1axis promotes progression of breast cancer via enhancement of epithelial-mesenchymal transition and activation of NF-B and -catenin.Cancer Lett. 2016 Apr 1;373(1):1-11. doi: 10.1016/j.canlet.2016.01.010. Epub 2016 Jan 19.
• [21] NAP1L1 is a prognostic biomarker and contribute to doxorubicin chemotherapy resistance in human hepatocellular carcinoma.Cancer Cell Int. 2019 Sep 5;19:228. doi: 10.1186/s12935-019-0949-0. eCollection 2019.
• [22] New MLLT10 gene recombinations in pediatric T-acute lymphoblastic leukemia.Blood. 2013 Jun 20;121(25):5064-7. doi: 10.1182/blood-2013-02-487256. Epub 2013 May 14.
• [23] Genetic alterations of the NRP/B gene are associated with human brain tumors.Oncogene. 2004 Aug 5;23(35):5890-900. doi: 10.1038/sj.onc.1207776.
• [24] miR126-5p Downregulation Facilitates Axon Degeneration and NMJ Disruption via a Non-Cell-Autonomous Mechanism in ALS.J Neurosci. 2018 Jun 13;38(24):5478-5494. doi: 10.1523/JNEUROSCI.3037-17.2018. Epub 2018 May 17.
• [25] The role of genetic markers--NAP1L1, MAGE-D2, and MTA1--in defining small-intestinal carcinoid neoplasia.Ann Surg Oncol. 2006 Feb;13(2):253-62. doi: 10.1245/ASO.2006.12.011. Epub 2006 Jan 20.
• [26] Overexpression of the neuropilin 1 (NRP1) gene correlated with poor prognosis in human glioma.Anticancer Res. 2004 Mar-Apr;24(2B):547-52.
• [27] Smad7 is inactivated through a direct physical interaction with the LIM protein Hic-5/ARA55.Oncogene. 2008 Nov 20;27(54):6791-805. doi: 10.1038/onc.2008.291. Epub 2008 Sep 1.
• [28] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [29] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [30] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [31] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [32] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [33] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [34] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [35] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [36] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
• [37] Inhibition of fatty acid synthase expression by 1alpha,25-dihydroxyvitamin D3 in prostate cancer cells. J Steroid Biochem Mol Biol. 2003 May;85(1):1-8. doi: 10.1016/s0960-0760(03)00142-0.
• [38] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [39] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [40] p21(WAF1/cip1) is an important determinant of intestinal cell response to sulindac in vitro and in vivo. Cancer Res. 2001 Aug 15;61(16):6297-302.
• [41] Gene expression profiling of early primary biliary cirrhosis: possible insights into the mechanism of action of ursodeoxycholic acid. Liver Int. 2008 Aug;28(7):997-1010. doi: 10.1111/j.1478-3231.2008.01744.x. Epub 2008 Apr 15.
• [42] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [43] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [44] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [45] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [46] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.