Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTID5AH2)

• DOT Name: Collagen alpha-1(XVII) chain (COL17A1)
• Synonyms: 180 kDa bullous pemphigoid antigen 2; Bullous pemphigoid antigen 2
• Gene Name: COL17A1
• Related Disease:
  Epithelial recurrent erosion dystrophy
  Junctional epidermolysis bullosa, non-Herlitz type
  Non-insulin dependent diabetes
  Actinic keratosis
  Adenocarcinoma
  Advanced cancer
  Alzheimer disease
  Amelogenesis imperfecta
  Androgenetic alopecia
  Baldness, male pattern
  Chronic idiopathic urticaria
  Corneal dystrophy
  Craniosynostosis
  Cytomegalovirus infection
  Dermatitis
  Epilepsy, idiopathic generalized
  High blood pressure
  Inborn error of immunity
  Leukocyte adhesion deficiency
  Leukocyte adhesion deficiency type 1
  Lichen planus
  Lung squamous cell carcinoma
  Motor neurone disease
  Multiple sclerosis
  Non-small-cell lung cancer
  Parkinson disease
  Pemphigus
  Primary biliary cholangitis
  Skin disease
  Squamous cell carcinoma
  Stroke
  Syphilis
  Autoimmune disease
  Cutaneous squamous cell carcinoma
  Epidermolysis bullosa simplex
  Glioblastoma multiforme
  Nasopharyngeal carcinoma
  Pancreatic cancer
  Generalized junctional epidermolysis bullosa non-Herlitz type
  Late-onset junctional epidermolysis bullosa
  Localized junctional epidermolysis bullosa, non-Herlitz type
  Dental enamel hypoplasia
  Melanoma
• UniProt ID: COHA1_HUMAN
• Pfam ID: PF01391
• Sequence:
  MDVTKKNKRDGTEVTERIVTETVTTRLTSLPPKGGTSNGYAKTASLGGGSRLEKQSLTHG
  SSGYINSTGSTRGHASTSSYRRAHSPASTLPNSPGSTFERKTHVTRHAYEGSSSGNSSPE
  YPRKEFASSSTRGRSQTRESEIRVRLQSASPSTRWTELDDVKRLLKGSRSASVSPTRNSS
  NTLPIPKKGTVETKIVTASSQSVSGTYDATILDANLPSHVWSSTLPAGSSMGTYHNNMTT
  QSSSLLNTNAYSAGSVFGVPNNMASCSPTLHPGLSTSSSVFGMQNNLAPSLTTLSHGTTT
  TSTAYGVKKNMPQSPAAVNTGVSTSAACTTSVQSDDLLHKDCKFLILEKDNTPAKKEMEL
  LIMTKDSGKVFTASPASIAATSFSEDTLKKEKQAAYNADSGLKAEANGDLKTVSTKGKTT
  TADIHSYGSSGGGGSGGGGGVGGAGGGPWGPAPAWCPCGSCCSWWKWLLGLLLTWLLLLG
  LLFGLIALAEEVRKLKARVDELERIRRSILPYGDSMDRIEKDRLQGMAPAAGADLDKIGL
  HSDSQEELWMFVRKKLMMEQENGNLRGSPGPKGDMGSPGPKGDRGFPGTPGIPGPLGHPG
  PQGPKGQKGSVGDPGMEGPMGQRGREGPMGPRGEAGPPGSGEKGERGAAGEPGPHGPPGV
  PGSVGPKGSSGSPGPQGPPGPVGLQGLRGEVGLPGVKGDKGPMGPPGPKGDQGEKGPRGL
  TGEPGMRGLPGAVGEPGAKGAMGPAGPDGHQGPRGEQGLTGMPGIRGPPGPSGDPGKPGL
  TGPQGPQGLPGTPGRPGIKGEPGAPGKIVTSEGSSMLTVPGPPGPPGAMGPPGPPGAPGP
  AGPAGLPGHQEVLNLQGPPGPPGPRGPPGPSIPGPPGPRGPPGEGLPGPPGPPGSFLSNS
  ETFLSGPPGPPGPPGPKGDQGPPGPRGHQGEQGLPGFSTSGSSSFGLNLQGPPGPPGPQG
  PKGDKGDPGVPGALGIPSGPSEGGSSSTMYVSGPPGPPGPPGPPGSISSSGQEIQQYISE
  YMQSDSIRSYLSGVQGPPGPPGPPGPVTTITGETFDYSELASHVVSYLRTSGYGVSLFSS
  SISSEDILAVLQRDDVRQYLRQYLMGPRGPPGPPGASGDGSLLSLDYAELSSRILSYMSS
  SGISIGLPGPPGPPGLPGTSYEELLSLLRGSEFRGIVGPPGPPGPPGIPGNVWSSISVED
  LSSYLHTAGLSFIPGPPGPPGPPGPRGPPGVSGALATYAAENSDSFRSELISYLTSPDVR
  SFIVGPPGPPGPQGPPGDSRLLSTDASHSRGSSSSSHSSSVRRGSSYSSSMSTGGGGAGS
  LGAGGAFGEAAGDRGPYGTDIGPGGGYGAAAEGGMYAGNGGLLGADFAGDLDYNELAVRV
  SESMQRQGLLQGMAYTVQGPPGQPGPQGPPGISKVFSAYSNVTADLMDFFQTYGAIQGPP
  GQKGEMGTPGPKGDRGPAGPPGHPGPPGPRGHKGEKGDKGDQVYAGRRRRRSIAVKP
• Function: May play a role in the integrity of hemidesmosome and the attachment of basal keratinocytes to the underlying basement membrane.; The 120 kDa linear IgA disease antigen is an anchoring filament component involved in dermal-epidermal cohesion. Is the target of linear IgA bullous dermatosis autoantibodies.
• Tissue Specificity: Detected in skin . In the cornea, it is detected in the epithelial basement membrane, the epithelial cells, and at a lower level in stromal cells (at protein level) . Stratified squamous epithelia. Found in hemidesmosomes. Expressed in cornea, oral mucosa, esophagus, intestine, kidney collecting ducts, ureter, bladder, urethra and thymus but is absent in lung, blood vessels, skeletal muscle and nerves.
• KEGG Pathway: Protein digestion and absorption (hsa04974)
• Reactome Pathway:
  Collagen biosynthesis and modifying enzymes (R-HSA-1650814)
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933)
  Assembly of collagen fibrils and other multimeric structures (R-HSA-2022090)
  Type I hemidesmosome assembly (R-HSA-446107)
  Collagen chain trimerization (R-HSA-8948216)
  Collagen degradation (R-HSA-1442490)

Molecular Interaction Atlas (MIA) of This DOT

43 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Epithelial recurrent erosion dystrophy	DIS2XPWB	Definitive	Autosomal dominant	[1]
Junctional epidermolysis bullosa, non-Herlitz type	DISQM23S	Definitive	Autosomal recessive	[2]
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Biomarker	[3]
Actinic keratosis	DISR1RC5	Strong	Altered Expression	[4]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[5]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[6]
Alzheimer disease	DISF8S70	Strong	Biomarker	[7]
Amelogenesis imperfecta	DISGYR9E	Strong	Genetic Variation	[8]
Androgenetic alopecia	DISSJR1P	Strong	Biomarker	[9]
Baldness, male pattern	DIS9C9RO	Strong	Biomarker	[9]
Chronic idiopathic urticaria	DISZA5CE	Strong	Biomarker	[10]
Corneal dystrophy	DISRDPA6	Strong	Genetic Variation	[11]
Craniosynostosis	DIS6J405	Strong	Biomarker	[12]
Cytomegalovirus infection	DISCEMGC	Strong	Biomarker	[13]
Dermatitis	DISY5SZC	Strong	Biomarker	[14]
Epilepsy, idiopathic generalized	DISODZC9	Strong	Altered Expression	[15]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[16]
Inborn error of immunity	DISNGCMN	Strong	Biomarker	[17]
Leukocyte adhesion deficiency	DISEJ9VG	Strong	Genetic Variation	[18]
Leukocyte adhesion deficiency type 1	DISA1J7W	Strong	Genetic Variation	[19]
Lichen planus	DISRPMMS	Strong	Altered Expression	[20]
Lung squamous cell carcinoma	DISXPIBD	Strong	Biomarker	[4]
Motor neurone disease	DISUHWUI	Strong	Altered Expression	[21]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[7]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[22]
Parkinson disease	DISQVHKL	Strong	Biomarker	[23]
Pemphigus	DISZAZ6M	Strong	Biomarker	[24]
Primary biliary cholangitis	DIS43E0O	Strong	Genetic Variation	[25]
Skin disease	DISDW8R6	Strong	Biomarker	[26]
Squamous cell carcinoma	DISQVIFL	Strong	Posttranslational Modification	[4]
Stroke	DISX6UHX	Strong	Biomarker	[27]
Syphilis	DISJ73BS	Strong	Biomarker	[28]
Autoimmune disease	DISORMTM	moderate	Biomarker	[29]
Cutaneous squamous cell carcinoma	DIS3LXUG	moderate	Altered Expression	[30]
Epidermolysis bullosa simplex	DIS2CZ6X	moderate	Genetic Variation	[31]
Glioblastoma multiforme	DISK8246	moderate	Altered Expression	[32]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Biomarker	[33]
Pancreatic cancer	DISJC981	moderate	Altered Expression	[34]
Generalized junctional epidermolysis bullosa non-Herlitz type	DISSD3MX	Supportive	Autosomal recessive	[35]
Late-onset junctional epidermolysis bullosa	DIS7SN8E	Supportive	Autosomal recessive	[36]
Localized junctional epidermolysis bullosa, non-Herlitz type	DIS1UMS1	Supportive	Autosomal recessive	[36]
Dental enamel hypoplasia	DISN6ZMR	Limited	Genetic Variation	[37]
Melanoma	DIS1RRCY	Limited	Biomarker	[38]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Collagen alpha-1(XVII) chain (COL17A1).	[39]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Collagen alpha-1(XVII) chain (COL17A1).	[40]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Collagen alpha-1(XVII) chain (COL17A1).	[42]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Collagen alpha-1(XVII) chain (COL17A1).	[43]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Collagen alpha-1(XVII) chain (COL17A1).	[44]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Collagen alpha-1(XVII) chain (COL17A1).	[39]
Alitretinoin	DMME8LH	Approved	Alitretinoin decreases the expression of Collagen alpha-1(XVII) chain (COL17A1).	[39]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Collagen alpha-1(XVII) chain (COL17A1).	[46]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Collagen alpha-1(XVII) chain (COL17A1).	[47]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Collagen alpha-1(XVII) chain (COL17A1).	[48]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID decreases the expression of Collagen alpha-1(XVII) chain (COL17A1).	[49]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Collagen alpha-1(XVII) chain (COL17A1).	[41]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ximelegatran	DMU8ANS	Approved	Ximelegatran affects the localization of Collagen alpha-1(XVII) chain (COL17A1).	[45]

References

• [1] A COL17A1 Splice-Altering Mutation Is Prevalent in Inherited Recurrent Corneal Erosions. Ophthalmology. 2016 Apr;123(4):709-22. doi: 10.1016/j.ophtha.2015.12.008. Epub 2016 Jan 16.
• [2] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [3] A Cross-Sectional Study Comparing the Prevalence of Bullous Pemphigoid Autoantibodies in 275 Cases of Type II Diabetes Mellitus Treated With or Without Dipeptidyl Peptidase-IV Inhibitors.Front Immunol. 2019 Jun 26;10:1439. doi: 10.3389/fimmu.2019.01439. eCollection 2019.
• [4] Aberrant expression of a hemidesmosomal protein, bullous pemphigoid antigen 2, in human squamous cell carcinoma.Lab Invest. 1996 Oct;75(4):589-600.
• [5] Distribution of basement membrane anchoring molecules in normal and transformed endometrium: altered expression of laminin gamma2 chain and collagen type XVII in endometrial adenocarcinomas.J Mol Histol. 2004 Nov;35(8-9):715-22. doi: 10.1007/s10735-004-1051-y.
• [6] Bullous pemphigoid: What's ahead?.J Dermatol. 2016 Mar;43(3):237-40. doi: 10.1111/1346-8138.13207. Epub 2015 Nov 25.
• [7] BP180 Autoantibodies Target Different Epitopes in Multiple Sclerosis or Alzheimer's Disease than in Bullous Pemphigoid.J Invest Dermatol. 2019 Feb;139(2):293-299. doi: 10.1016/j.jid.2018.09.010. Epub 2018 Oct 10.
• [8] A targeted next-generation sequencing assay for the molecular diagnosis of genetic disorders with orodental involvement.J Med Genet. 2016 Feb;53(2):98-110. doi: 10.1136/jmedgenet-2015-103302. Epub 2015 Oct 26.
• [9] Expression of anti-aging type-XVII collagen (COL17A1/BP180) in hair follicle-associated pluripotent (HAP) stem cells during differentiation.Tissue Cell. 2019 Aug;59:33-38. doi: 10.1016/j.tice.2019.06.001. Epub 2019 Jun 21.
• [10] Immunoglobulin E-Mediated Autoimmunity.Front Immunol. 2018 Apr 9;9:689. doi: 10.3389/fimmu.2018.00689. eCollection 2018.
• [11] Clinical and genetic update of corneal dystrophies.Exp Eye Res. 2019 Sep;186:107715. doi: 10.1016/j.exer.2019.107715. Epub 2019 Jul 10.
• [12] A role for anti-BP180 autoantibodies in chronic rhinosinusitis.Laryngoscope. 2013 Sep;123(9):2104-11. doi: 10.1002/lary.24016.
• [13] Bullous pemphigoid complicated by cytomegalovirus disease as a manifestation of immune reconstitution inflammatory syndrome: retrospective analyses of our institutional cases and literature review.Int J Dermatol. 2018 Feb;57(2):202-208. doi: 10.1111/ijd.13799. Epub 2017 Dec 2.
• [14] The Autoimmune Skin Disease Bullous Pemphigoid: The Role of Mast Cells in Autoantibody-Induced Tissue Injury.Front Immunol. 2018 Mar 1;9:407. doi: 10.3389/fimmu.2018.00407. eCollection 2018.
• [15] Basement membrane zone IgE deposition is associated with bullous pemphigoid disease severity and treatment results.Br J Dermatol. 2020 May;182(5):1221-1227. doi: 10.1111/bjd.18364. Epub 2019 Oct 16.
• [16] Identification of six polymorphisms as novel susceptibility loci for ischemic or hemorrhagic stroke by exome-wide association studies.Int J Mol Med. 2017 Jun;39(6):1477-1491. doi: 10.3892/ijmm.2017.2972. Epub 2017 May 3.
• [17] Successful allogeneic stem cell transplantation with a reduced-intensity conditioning in a leukocyte adhesion deficiency type I patient.Pediatr Transplant. 2011 Mar;15(2):E30-3. doi: 10.1111/j.1399-3046.2009.01239.x.
• [18] Characterization of single amino acid substitutions in the 2 integrin subunit of patients with leukocyte adhesion deficiency (LAD)-1.Blood Cells Mol Dis. 2015 Feb;54(2):177-82. doi: 10.1016/j.bcmd.2014.11.005. Epub 2014 Nov 28.
• [19] CD18 deficiency evolving to megakaryocytic (M7) acute myeloid leukemia: case report.Blood Cells Mol Dis. 2014 Dec;53(4):180-4. doi: 10.1016/j.bcmd.2014.07.005. Epub 2014 Aug 5.
• [20] Epithelial antigenic specificities of circulating autoantibodies in mucosal lichen planus.Int J Dermatol. 2016 Jun;55(6):634-9. doi: 10.1111/ijd.12990. Epub 2015 Nov 13.
• [21] Expression of collagen XVII and ubiquitin-binding protein p62 in motor neuron disease.Brain Res. 2009 Jan 9;1247:171-7. doi: 10.1016/j.brainres.2008.10.020. Epub 2008 Nov 1.
• [22] BP180-specific IgG is associated with skin adverse events, therapy response, and overall survival in non-small cell lung cancer patients treated with checkpoint inhibitors.J Am Acad Dermatol. 2020 Apr;82(4):854-861. doi: 10.1016/j.jaad.2019.08.045. Epub 2019 Aug 23.
• [23] Neurological and psychiatric associations in bullous pemphigoid-more than skin deep?.Exp Dermatol. 2017 Dec;26(12):1228-1234. doi: 10.1111/exd.13401. Epub 2017 Sep 24.
• [24] Validation of chemiluminescent enzyme immunoassay in detection of autoantibodies in pemphigus and pemphigoid.J Dermatol Sci. 2017 Mar;85(3):208-215. doi: 10.1016/j.jdermsci.2016.12.007. Epub 2016 Dec 6.
• [25] Genome-wide association study identifies TNFSF15 and POU2AF1 as susceptibility loci for primary biliary cirrhosis in the Japanese population.Am J Hum Genet. 2012 Oct 5;91(4):721-8. doi: 10.1016/j.ajhg.2012.08.010. Epub 2012 Sep 20.
• [26] Checkpoint Inhibition May Trigger the Rare Variant of Anti-LAD-1 IgG-Positive, Anti-BP180 NC16A IgG-Negative Bullous Pemphigoid.Front Immunol. 2019 Aug 14;10:1934. doi: 10.3389/fimmu.2019.01934. eCollection 2019.
• [27] Anti-BP180 Autoantibodies Are Present in Stroke and Recognize Human Cutaneous BP180 and BP180-NC16A.Front Immunol. 2019 Feb 26;10:236. doi: 10.3389/fimmu.2019.00236. eCollection 2019.
• [28] Prevalence of Skin-specific Autoantibodies in HIV-infected Patients and Uninfected Controls.Acta Derm Venereol. 2019 Oct 1;99(11):978-983. doi: 10.2340/00015555-3251.
• [29] Gliptin-Associated Bullous Pemphigoid: A Valuable Model of the Mechanism of Breakdown of Immune Tolerance against BP180.J Invest Dermatol. 2019 Apr;139(4):755-756. doi: 10.1016/j.jid.2018.11.025.
• [30] Collagen XVII/BP180 protein expression in squamous cell carcinoma of the skin detected with novel monoclonal antibodies in archived tissues using tissue microarrays and digital microscopy.Appl Immunohistochem Mol Morphol. 2008 Oct;16(5):433-41. doi: 10.1097/PAI.0b013e318162f8aa.
• [31] Features of epidermolysis bullosa simplex due to mutations in the ectodomain of type XVII collagen.Br J Dermatol. 2004 Sep;151(3):669-74. doi: 10.1111/j.1365-2133.2004.06041.x.
• [32] A PTEN-COL17A1 fusion gene and its novel regulatory role in Collagen XVII expression and GBM malignance.Oncotarget. 2017 Aug 24;8(49):85794-85803. doi: 10.18632/oncotarget.20526. eCollection 2017 Oct 17.
• [33] Downregulation of hemidesmosomal proteins in nasopharyngeal carcinoma cells.Cancer Lett. 2001 Feb 10;163(1):117-23. doi: 10.1016/s0304-3835(00)00683-2.
• [34] Key genes associated with pancreatic cancer and their association with outcomes: A bioinformatics analysis.Mol Med Rep. 2019 Aug;20(2):1343-1352. doi: 10.3892/mmr.2019.10321. Epub 2019 Jun 3.
• [35] Junctional Epidermolysis Bullosa. 2008 Feb 22 [updated 2018 Dec 20]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
• [36] Clinical Practice Guidelines for Rare Diseases: The Orphanet Database. PLoS One. 2017 Jan 18;12(1):e0170365. doi: 10.1371/journal.pone.0170365. eCollection 2017.
• [37] Analysis of the COL17A1 in non-Herlitz junctional epidermolysis bullosa and amelogenesis imperfecta.Int J Mol Med. 2006 Aug;18(2):333-7.
• [38] The dysfunction of BP180/collagen XVII in keratinocytes promotes melanoma progression.Oncogene. 2019 Dec;38(50):7491-7503. doi: 10.1038/s41388-019-0961-9. Epub 2019 Aug 21.
• [39] Retinoic acid and its 4-oxo metabolites are functionally active in human skin cells in vitro. J Invest Dermatol. 2005 Jul;125(1):143-53.
• [40] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [41] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [42] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [43] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [44] Characterization of DOK1, a candidate tumor suppressor gene, in epithelial ovarian cancer. Mol Oncol. 2011 Oct;5(5):438-53. doi: 10.1016/j.molonc.2011.07.003. Epub 2011 Jul 26.
• [45] Myosin-mediated cytoskeleton contraction and Rho GTPases regulate laminin-5 matrix assembly. Cell Motil Cytoskeleton. 2004 Feb;57(2):107-17. doi: 10.1002/cm.10161.
• [46] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [47] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [48] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [49] Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.