Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIG527N)

• DOT Name: Laminin subunit gamma-1 (LAMC1)
• Synonyms: Laminin B2 chain; Laminin-1 subunit gamma; Laminin-10 subunit gamma; Laminin-11 subunit gamma; Laminin-2 subunit gamma; Laminin-3 subunit gamma; Laminin-4 subunit gamma; Laminin-6 subunit gamma; Laminin-7 subunit gamma; Laminin-8 subunit gamma; Laminin-9 subunit gamma; S-laminin subunit gamma; S-LAM gamma
• Gene Name: LAMC1
• Related Disease:
  Anaplastic astrocytoma
  Prostate carcinoma
  Advanced cancer
  Alzheimer disease
  Aortic disorder
  Brain neoplasm
  Chronic kidney disease
  Colon cancer
  Colorectal adenocarcinoma
  Colorectal adenoma
  Colorectal cancer
  Colorectal cancer, susceptibility to, 1
  Colorectal cancer, susceptibility to, 10
  Colorectal cancer, susceptibility to, 12
  Colorectal carcinoma
  Colorectal neoplasm
  Dandy-Walker syndrome
  DiGeorge syndrome
  Endometrial carcinoma
  Fuchs' endothelial dystrophy
  Glioblastoma multiforme
  Glioma
  Hepatocellular carcinoma
  Lipoid proteinosis
  Marfan syndrome
  Neoplasm
  Shprintzen-Goldberg syndrome
  Systemic lupus erythematosus
  Female hypogonadism
  Amyotrophic lateral sclerosis
  Cutaneous squamous cell carcinoma
  Prostate cancer
  Prostate neoplasm
• UniProt ID: LAMC1_HUMAN
• PDB ID: 5XAU; 7CEC; 8DMK
• Pfam ID: PF00052 ; PF00053 ; PF00055
• Sequence:
  MRGSHRAAPALRPRGRLWPVLAVLAAAAAAGCAQAAMDECTDEGGRPQRCMPEFVNAAFN
  VTVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQS
  QTMLAGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSG
  SCENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVL
  QEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECMKNEF
  DKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRS
  TGHGGHCTNCQDNTDGAHCERCRENFFRLGNNEACSSCHCSPVGSLSTQCDSYGRCSCKP
  GVMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSIDECNIETGRCVCKDNVEGFNCERCKPG
  FFNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSISSTFQIDEDGWRAEQRDGSEASLEW
  SSERQDIAVISDSYFPRYFIAPAKFLGKQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGA
  GLRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPALTPFEFQKLLNNLTSIKIRGTY
  SERSAGYLDDVTLASARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPNLGPYSP
  CVLCACNGHSETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSSDCQPCPCPGGSS
  CAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCSDNIDPNAVG
  NCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNLYGTMKQQSSCNP
  VTGQCECLPHVTGQDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGI
  TGQHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDQCEENYF
  YNRSWPGCQECPACYRLVKDKVADHRVKLQELESLIANLGTGDEMVTDQAFEDRLKEAER
  EVMDLLREAQDVKDVDQNLMDRLQRVNNTLSSQISRLQNIRNTIEETGNLAEQARAHVEN
  TERLIEIASRELEKAKVAAANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRV
  AKTANDTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKRA
  GDKAVEIYASVAQLSPLDSETLENEANNIKMEAENLEQLIDQKLKDYEDLREDMRGKELE
  VKNLLEKGKTEQQTADQLLARADAAKALAEEAAKKGRDTLQEANDILNNLKDFDRRVNDN
  KTAAEEALRKIPAINQTITEANEKTREAQQALGSAAADATEAKNKAHEAERIASAVQKNA
  TSTKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAE
  INARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSD
  LENEAKKQEAAIMDYNRDIEEIMKDIRNLEDIRKTLPSGCFNTPSIEKP
• Function: Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
• Tissue Specificity: Found in the basement membranes (major component).
• KEGG Pathway:
  PI3K-Akt sig.ling pathway (hsa04151)
  Focal adhesion (hsa04510)
  ECM-receptor interaction (hsa04512)
  Prion disease (hsa05020)
  Toxoplasmosis (hsa05145)
  Amoebiasis (hsa05146)
  Human papillomavirus infection (hsa05165)
  Pathways in cancer (hsa05200)
  Small cell lung cancer (hsa05222)
• Reactome Pathway:
  Laminin interactions (R-HSA-3000157)
  Non-integrin membrane-ECM interactions (R-HSA-3000171)
  ECM proteoglycans (R-HSA-3000178)
  L1CAM interactions (R-HSA-373760)
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)
  MET activates PTK2 signaling (R-HSA-8874081)
  Post-translational protein phosphorylation (R-HSA-8957275)
  EGR2 and SOX10-mediated initiation of Schwann cell myelination (R-HSA-9619665)
  Degradation of the extracellular matrix (R-HSA-1474228)

Molecular Interaction Atlas (MIA) of This DOT

33 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Anaplastic astrocytoma	DISSBE0K	Definitive	Biomarker	[1]
Prostate carcinoma	DISMJPLE	Definitive	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[4]
Aortic disorder	DISKXISV	Strong	Biomarker	[5]
Brain neoplasm	DISY3EKS	Strong	Biomarker	[6]
Chronic kidney disease	DISW82R7	Strong	Altered Expression	[7]
Colon cancer	DISVC52G	Strong	Genetic Variation	[8]
Colorectal adenocarcinoma	DISPQOUB	Strong	Genetic Variation	[8]
Colorectal adenoma	DISTSVHM	Strong	Genetic Variation	[9]
Colorectal cancer	DISNH7P9	Strong	Genetic Variation	[8]
Colorectal cancer, susceptibility to, 1	DISZ794C	Strong	Genetic Variation	[8]
Colorectal cancer, susceptibility to, 10	DISQXMYM	Strong	Genetic Variation	[8]
Colorectal cancer, susceptibility to, 12	DIS4FXJX	Strong	Genetic Variation	[8]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[8]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[8]
Dandy-Walker syndrome	DIS4HC6W	Strong	Genetic Variation	[10]
DiGeorge syndrome	DIST1RKO	Strong	Biomarker	[11]
Endometrial carcinoma	DISXR5CY	Strong	Altered Expression	[12]
Fuchs' endothelial dystrophy	DISL7TXC	Strong	Genetic Variation	[13]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[14]
Glioma	DIS5RPEH	Strong	Biomarker	[15]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[16]
Lipoid proteinosis	DISHAODY	Strong	Altered Expression	[17]
Marfan syndrome	DISVEUWZ	Strong	Biomarker	[5]
Neoplasm	DISZKGEW	Strong	Biomarker	[16]
Shprintzen-Goldberg syndrome	DISQH6P3	Strong	Biomarker	[11]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[18]
Female hypogonadism	DISWASB4	moderate	Biomarker	[19]
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Altered Expression	[20]
Cutaneous squamous cell carcinoma	DIS3LXUG	Limited	Altered Expression	[3]
Prostate cancer	DISF190Y	Limited	Biomarker	[2]
Prostate neoplasm	DISHDKGQ	Limited	Biomarker	[21]

This DOT Affected the Drug Response of 4 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Methotrexate	DM2TEOL	Approved	Laminin subunit gamma-1 (LAMC1) affects the response to substance of Methotrexate.	[46]
Fluorouracil	DMUM7HZ	Approved	Laminin subunit gamma-1 (LAMC1) affects the response to substance of Fluorouracil.	[46]
Topotecan	DMP6G8T	Approved	Laminin subunit gamma-1 (LAMC1) affects the response to substance of Topotecan.	[46]
Mitoxantrone	DMM39BF	Approved	Laminin subunit gamma-1 (LAMC1) affects the response to substance of Mitoxantrone.	[46]

23 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Laminin subunit gamma-1 (LAMC1).	[22]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Laminin subunit gamma-1 (LAMC1).	[23]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Laminin subunit gamma-1 (LAMC1).	[24]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Laminin subunit gamma-1 (LAMC1).	[25]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Laminin subunit gamma-1 (LAMC1).	[26]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Laminin subunit gamma-1 (LAMC1).	[27]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Laminin subunit gamma-1 (LAMC1).	[28]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Laminin subunit gamma-1 (LAMC1).	[29]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Laminin subunit gamma-1 (LAMC1).	[30]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Laminin subunit gamma-1 (LAMC1).	[31]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Laminin subunit gamma-1 (LAMC1).	[32]
Indomethacin	DMSC4A7	Approved	Indomethacin decreases the expression of Laminin subunit gamma-1 (LAMC1).	[14]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Laminin subunit gamma-1 (LAMC1).	[34]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Laminin subunit gamma-1 (LAMC1).	[35]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene decreases the expression of Laminin subunit gamma-1 (LAMC1).	[24]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Laminin subunit gamma-1 (LAMC1).	[37]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Laminin subunit gamma-1 (LAMC1).	[38]
SB-431542	DM0YOXQ	Preclinical	SB-431542 increases the expression of Laminin subunit gamma-1 (LAMC1).	[39]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Laminin subunit gamma-1 (LAMC1).	[41]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Laminin subunit gamma-1 (LAMC1).	[42]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride increases the expression of Laminin subunit gamma-1 (LAMC1).	[43]
Butanoic acid	DMTAJP7	Investigative	Butanoic acid increases the expression of Laminin subunit gamma-1 (LAMC1).	[44]
ORG2058	DMH1M6N	Investigative	ORG2058 decreases the expression of Laminin subunit gamma-1 (LAMC1).	[45]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Resveratrol	DM3RWXL	Phase 3	Resveratrol affects the secretion of Laminin subunit gamma-1 (LAMC1).	[36]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Laminin subunit gamma-1 (LAMC1).	[40]

References

• [1] Identification of COL1A1 as an invasionrelated gene in malignant astrocytoma.Int J Oncol. 2018 Dec;53(6):2542-2554. doi: 10.3892/ijo.2018.4568. Epub 2018 Sep 21.
• [2] miR-22 and miR-29a Are Members of the Androgen Receptor Cistrome Modulating LAMC1 and Mcl-1 in Prostate Cancer.Mol Endocrinol. 2015 Jul;29(7):1037-54. doi: 10.1210/me.2014-1358. Epub 2015 Jun 8.
• [3] miR-506 contributes to malignancy of cutaneous squamous cell carcinoma via targeting of P65 and LAMC1.Cell Cycle. 2019 Feb;18(3):333-345. doi: 10.1080/15384101.2019.1568747. Epub 2019 Jan 24.
• [4] Differential distribution of laminins in Alzheimer disease and normal human brain tissue.J Neurosci Res. 2002 Jul 15;69(2):243-56. doi: 10.1002/jnr.10292.
• [5] Analysis of oxidative stress enzymes and structural and functional proteins on human aortic tissue from different aortopathies.Oxid Med Cell Longev. 2014;2014:760694. doi: 10.1155/2014/760694. Epub 2014 Jul 1.
• [6] Changes in laminin isoforms associated with brain tumor invasion and angiogenesis.Front Biosci. 2006 Jan 1;11:81-8. doi: 10.2741/1781.
• [7] A novel biomarker of laminin turnover is associated with disease progression and mortality in chronic kidney disease.PLoS One. 2018 Oct 1;13(10):e0204239. doi: 10.1371/journal.pone.0204239. eCollection 2018.
• [8] Novel Common Genetic Susceptibility Loci for Colorectal Cancer.J Natl Cancer Inst. 2019 Feb 1;111(2):146-157. doi: 10.1093/jnci/djy099.
• [9] Discovery of common and rare genetic risk variants for colorectal cancer.Nat Genet. 2019 Jan;51(1):76-87. doi: 10.1038/s41588-018-0286-6. Epub 2018 Dec 3.
• [10] Mutations in extracellular matrix genes NID1 and LAMC1 cause autosomal dominant Dandy-Walker malformation and occipital cephaloceles.Hum Mutat. 2013 Aug;34(8):1075-9. doi: 10.1002/humu.22351. Epub 2013 May 28.
• [11] Isolation of a novel gene from the DiGeorge syndrome critical region with homology to Drosophila gdl and to human LAMC1 genes.Hum Mol Genet. 1996 May;5(5):633-8. doi: 10.1093/hmg/5.5.633.
• [12] Laminin C1 expression by uterine carcinoma cells is associated with tumor progression.Gynecol Oncol. 2015 Nov;139(2):338-44. doi: 10.1016/j.ygyno.2015.08.025. Epub 2015 Sep 3.
• [13] Genome-wide association study identifies three novel loci in Fuchs endothelial corneal dystrophy.Nat Commun. 2017 Mar 30;8:14898. doi: 10.1038/ncomms14898.
• [14] The cyclooxygenase inhibitor indomethacin modulates gene expression and represses the extracellular matrix protein laminin gamma1 in human glioblastoma cells. Exp Cell Res. 2005 Jan 15;302(2):244-52. doi: 10.1016/j.yexcr.2004.09.021.
• [15] High LAMC1 expression in glioma is associated with poor prognosis.Onco Targets Ther. 2019 May 29;12:4253-4260. doi: 10.2147/OTT.S205333. eCollection 2019.
• [16] Lamc1 promotes the Warburg effect in hepatocellular carcinoma cells by regulating PKM2 expression through AKT pathway.Cancer Biol Ther. 2019;20(5):711-719. doi: 10.1080/15384047.2018.1564558. Epub 2019 Feb 12.
• [17] Expression of basement membrane zone genes coding for type IV procollagen and laminin by human skin fibroblasts in vitro: elevated alpha 1 (IV) collagen mRNA levels in lipoid proteinosis.J Invest Dermatol. 1988 May;90(5):734-8. doi: 10.1111/1523-1747.ep12560934.
• [18] Laminin-1 (LM-111) in preeclampsia and systemic lupus erythematosus.Autoimmunity. 2013 Feb;46(1):14-20. doi: 10.3109/08916934.2012.730586. Epub 2012 Dec 3.
• [19] LAMC1 gene is associated with premature ovarian failure.Maturitas. 2012 Apr;71(4):402-6. doi: 10.1016/j.maturitas.2012.01.011. Epub 2012 Feb 10.
• [20] Selective overexpression of gamma1 laminin in astrocytes in amyotrophic lateral sclerosis indicates an involvement in ALS pathology.J Neurosci Res. 2007 Jul;85(9):2045-58. doi: 10.1002/jnr.21314.
• [21] Global analysis of differentially expressed genes in androgen-independent prostate cancer.Prostate Cancer Prostatic Dis. 2007;10(2):167-74. doi: 10.1038/sj.pcan.4500933. Epub 2007 Jan 2.
• [22] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [23] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [24] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [25] Pretreatment of 3-MA prevents doxorubicin-induced cardiotoxicity through inhibition of autophagy initiation. Toxicology. 2023 May 15;490:153512. doi: 10.1016/j.tox.2023.153512. Epub 2023 Apr 14.
• [26] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [27] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [28] Gene expression profile changes in NB4 cells induced by arsenic trioxide. Acta Pharmacol Sin. 2003 Jul;24(7):646-50.
• [29] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [30] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [31] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [32] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [33] The cyclooxygenase inhibitor indomethacin modulates gene expression and represses the extracellular matrix protein laminin gamma1 in human glioblastoma cells. Exp Cell Res. 2005 Jan 15;302(2):244-52. doi: 10.1016/j.yexcr.2004.09.021.
• [34] Unique bisphenol A transcriptome in prostate cancer: novel effects on ERbeta expression that correspond to androgen receptor mutation status. Environ Health Perspect. 2007 Nov;115(11):1646-53. doi: 10.1289/ehp.10283.
• [35] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [36] Calorie restriction-induced changes in the secretome of human adipocytes, comparison with resveratrol-induced secretome effects. Biochim Biophys Acta. 2014 Sep;1844(9):1511-22. doi: 10.1016/j.bbapap.2014.04.023. Epub 2014 May 5.
• [37] Changes in gene expressions elicited by physiological concentrations of genistein on human endometrial cancer cells. Mol Carcinog. 2006 Oct;45(10):752-63.
• [38] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [39] Activin/nodal signaling switches the terminal fate of human embryonic stem cell-derived trophoblasts. J Biol Chem. 2015 Apr 3;290(14):8834-48.
• [40] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [41] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [42] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [43] Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.
• [44] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
• [45] The antiproliferative effects of progestins in T47D breast cancer cells are tempered by progestin induction of the ETS transcription factor Elf5. Mol Endocrinol. 2010 Jul;24(7):1380-92. doi: 10.1210/me.2009-0516. Epub 2010 Jun 2.
• [46] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.